Lus10042234 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30300 102 / 4e-26 Major facilitator superfamily protein (.1)
AT5G45275 86 / 4e-20 Major facilitator superfamily protein (.1)
AT1G31470 83 / 3e-19 NFD4 NUCLEAR FUSION DEFECTIVE 4, Major facilitator superfamily protein (.1)
AT3G01630 79 / 1e-17 Major facilitator superfamily protein (.1)
AT4G19450 77 / 5e-17 Major facilitator superfamily protein (.1)
AT2G16660 60 / 4e-11 Major facilitator superfamily protein (.1)
AT4G34950 55 / 2e-09 Major facilitator superfamily protein (.1)
AT1G80530 52 / 2e-08 Major facilitator superfamily protein (.1)
AT5G50520 44 / 1e-05 Major facilitator superfamily protein (.1)
AT5G50630 44 / 1e-05 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026422 214 / 2e-67 AT2G30300 379 / 5e-126 Major facilitator superfamily protein (.1)
Lus10015469 109 / 2e-28 AT2G30300 396 / 5e-133 Major facilitator superfamily protein (.1)
Lus10019941 106 / 2e-27 AT2G30300 307 / 1e-98 Major facilitator superfamily protein (.1)
Lus10015470 100 / 2e-25 AT2G30300 351 / 2e-115 Major facilitator superfamily protein (.1)
Lus10033270 93 / 6e-25 AT5G45275 178 / 4e-54 Major facilitator superfamily protein (.1)
Lus10034738 67 / 1e-13 AT4G19450 691 / 0.0 Major facilitator superfamily protein (.1)
Lus10025053 57 / 3e-10 AT4G34950 793 / 0.0 Major facilitator superfamily protein (.1)
Lus10034491 57 / 5e-10 AT4G34950 788 / 0.0 Major facilitator superfamily protein (.1)
Lus10001678 56 / 2e-09 AT1G80530 649 / 0.0 Major facilitator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G154000 135 / 4e-38 AT2G30300 380 / 4e-127 Major facilitator superfamily protein (.1)
Potri.019G126700 131 / 1e-36 AT2G30300 427 / 4e-145 Major facilitator superfamily protein (.1)
Potri.013G084000 84 / 1e-19 AT2G30300 241 / 2e-73 Major facilitator superfamily protein (.1)
Potri.001G128200 84 / 2e-19 AT4G19450 774 / 0.0 Major facilitator superfamily protein (.1)
Potri.003G105600 82 / 9e-19 AT4G19450 734 / 0.0 Major facilitator superfamily protein (.1)
Potri.004G173400 61 / 2e-11 AT4G34950 682 / 0.0 Major facilitator superfamily protein (.1)
Potri.009G132700 60 / 4e-11 AT4G34950 661 / 0.0 Major facilitator superfamily protein (.1)
Potri.006G060900 56 / 1e-09 AT1G80530 632 / 0.0 Major facilitator superfamily protein (.1)
Potri.003G012300 52 / 3e-08 AT1G80530 650 / 0.0 Major facilitator superfamily protein (.1)
Potri.001G204700 45 / 5e-06 AT1G80530 625 / 0.0 Major facilitator superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10042234 pacid=23153714 polypeptide=Lus10042234 locus=Lus10042234.g ID=Lus10042234.BGIv1.0 annot-version=v1.0
ATGGCACTAATGGCATCAGCATTTTTGTTACTTGTCACAACTCGAACCCCCCAATATCACCTCAGCCTCTACATAGCCACAGGCATCATATCGGTGAGCA
CAGGGGCAATAACTTCGATCGCTGTTTCAACAACCACCCAACTCTTCGGCACCACCAGCTTCAGCATCAACCACAACGTTGTGGTCTCCAACATCCCTCT
TGGCTCTTTCGCTTACGGCTATCTGGCCGCCTTCATTTATCGCAGGAGTAGTGCCGTTGGTGGCGTTGGTGATGGAGAAGGGATCAAGTGTATGGGTGTG
GAGTGTTATCGAGATACGTTTGTGATTTGGGGGTCGCTTTGTGGGGTTGGTGCGGTTCTTGCTCTCGTTCTTCATTGTAGGATGATGAGGGTAAGGCGGA
GGAAGAGGGACGGTGGTGAGTTTTTTGTCGGAGGATTGACTGGTTGA
AA sequence
>Lus10042234 pacid=23153714 polypeptide=Lus10042234 locus=Lus10042234.g ID=Lus10042234.BGIv1.0 annot-version=v1.0
MALMASAFLLLVTTRTPQYHLSLYIATGIISVSTGAITSIAVSTTTQLFGTTSFSINHNVVVSNIPLGSFAYGYLAAFIYRRSSAVGGVGDGEGIKCMGV
ECYRDTFVIWGSLCGVGAVLALVLHCRMMRVRRRKRDGGEFFVGGLTG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G30300 Major facilitator superfamily ... Lus10042234 0 1
AT1G79510 Uncharacterized conserved prot... Lus10001766 4.9 0.9127
AT3G59010 PME61, PME35 pectin methylesterase 61 (.1) Lus10025510 8.0 0.9067
AT5G53390 O-acyltransferase (WSD1-like) ... Lus10039843 10.1 0.9026
AT5G10770 Eukaryotic aspartyl protease f... Lus10038732 11.0 0.8926
AT2G30300 Major facilitator superfamily ... Lus10026422 12.4 0.8907
AT4G15440 CYP74B2, HPL1 hydroperoxide lyase 1 (.1) Lus10015138 16.6 0.8881
AT4G09350 NdhT, CRRJ NADH dehydrogenase-like comple... Lus10029740 19.3 0.8860
AT5G57800 CER3, FLP1, YRE... FACELESS POLLEN 1, ECERIFERUM ... Lus10008895 20.3 0.8823
AT3G24420 alpha/beta-Hydrolases superfam... Lus10017735 21.4 0.8830
AT3G18280 Bifunctional inhibitor/lipid-t... Lus10017616 22.1 0.8276

Lus10042234 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.