Lus10042241 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22590 168 / 6e-51 UDP-Glycosyltransferase superfamily protein (.1)
AT5G65550 148 / 2e-43 UDP-Glycosyltransferase superfamily protein (.1)
AT5G49690 142 / 4e-41 UDP-Glycosyltransferase superfamily protein (.1)
AT5G54060 90 / 1e-21 UF3GT UDP-glucose:flavonoid 3-o-glucosyltransferase (.1)
AT1G64920 84 / 6e-20 UDP-Glycosyltransferase superfamily protein (.1)
AT5G54010 84 / 8e-20 UDP-Glycosyltransferase superfamily protein (.1)
AT3G29630 78 / 1e-17 UDP-Glycosyltransferase superfamily protein (.1)
AT4G09500 77 / 3e-17 UDP-Glycosyltransferase superfamily protein (.1.2)
AT4G27570 76 / 7e-17 UDP-Glycosyltransferase superfamily protein (.1)
AT1G50580 76 / 7e-17 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026412 211 / 2e-71 AT2G22590 173 / 1e-52 UDP-Glycosyltransferase superfamily protein (.1)
Lus10025711 155 / 4e-46 AT2G22590 473 / 2e-164 UDP-Glycosyltransferase superfamily protein (.1)
Lus10035951 147 / 4e-43 AT2G22590 464 / 3e-161 UDP-Glycosyltransferase superfamily protein (.1)
Lus10012726 142 / 3e-41 AT2G22590 471 / 3e-164 UDP-Glycosyltransferase superfamily protein (.1)
Lus10026410 119 / 3e-35 AT5G65550 82 / 1e-18 UDP-Glycosyltransferase superfamily protein (.1)
Lus10027850 122 / 8e-34 AT5G49690 560 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003154 91 / 4e-22 AT5G54010 318 / 3e-104 UDP-Glycosyltransferase superfamily protein (.1)
Lus10013337 91 / 6e-22 AT5G54010 452 / 1e-156 UDP-Glycosyltransferase superfamily protein (.1)
Lus10008453 87 / 1e-20 AT5G54010 539 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G182575 153 / 3e-45 AT5G49690 468 / 7e-163 UDP-Glycosyltransferase superfamily protein (.1)
Potri.001G030600 152 / 8e-45 AT2G22590 537 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Potri.012G034100 144 / 7e-42 AT2G22590 505 / 2e-177 UDP-Glycosyltransferase superfamily protein (.1)
Potri.003G184400 137 / 4e-39 AT5G49690 549 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Potri.014G088400 130 / 2e-36 AT2G22590 374 / 4e-125 UDP-Glycosyltransferase superfamily protein (.1)
Potri.002G162300 126 / 4e-35 AT2G22590 372 / 6e-125 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G042800 122 / 7e-34 AT5G49690 377 / 3e-127 UDP-Glycosyltransferase superfamily protein (.1)
Potri.006G179700 88 / 4e-21 AT5G54010 349 / 2e-116 UDP-Glycosyltransferase superfamily protein (.1)
Potri.011G097900 85 / 6e-20 AT5G54010 498 / 1e-174 UDP-Glycosyltransferase superfamily protein (.1)
Potri.011G061000 79 / 5e-18 AT5G54010 468 / 6e-163 UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10042241 pacid=23153970 polypeptide=Lus10042241 locus=Lus10042241.g ID=Lus10042241.BGIv1.0 annot-version=v1.0
ATGGCGGACGACGAAATCCACAAGAAGCTCCACATCGCAGTCTTCCCATGGCTAGCATTCGGTCACATGATTCCATTCCTAGAGCTCTCCAAGCTCTTAG
CCCAAGAAGGCCACTCGATTTCCTACATCTCAACACCACGTAACATCAACCGTCTCCCCCAATTCCCTGCTCATCTCACTCACCTCTTTAACTTCGTCCG
GATTCCTCTCCCCGCCGGCGATGGGAACCTCCCCGACGGAGCTGAATCGACCTCCGATCTCCCCCAGCACCTTGTCCCTTACCTCAAGCTCGCATACGAC
GCTCTCGAACCGGAGCTGACCCAATTCCTCGAGACCGAACGACCTGACTGGGTAATTTACGATTTCGCCCCTCACTGGCTCCCGCCCACAGCAGACCAGA
TCCGCGGTATCCGATAG
AA sequence
>Lus10042241 pacid=23153970 polypeptide=Lus10042241 locus=Lus10042241.g ID=Lus10042241.BGIv1.0 annot-version=v1.0
MADDEIHKKLHIAVFPWLAFGHMIPFLELSKLLAQEGHSISYISTPRNINRLPQFPAHLTHLFNFVRIPLPAGDGNLPDGAESTSDLPQHLVPYLKLAYD
ALEPELTQFLETERPDWVIYDFAPHWLPPTADQIRGIR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G65550 UDP-Glycosyltransferase superf... Lus10042241 0 1
AT5G65550 UDP-Glycosyltransferase superf... Lus10042242 1.0 0.9051
AT2G31040 ATP synthase protein I -relate... Lus10029836 6.8 0.8463
AT4G28030 Acyl-CoA N-acyltransferases (N... Lus10019975 12.1 0.8146
AT4G02340 alpha/beta-Hydrolases superfam... Lus10037559 14.0 0.7870
AT2G31040 ATP synthase protein I -relate... Lus10020702 14.1 0.8258
AT3G17950 unknown protein Lus10006150 16.2 0.7974
AT2G28260 ATCNGC15 cyclic nucleotide-gated channe... Lus10041319 16.6 0.8164
AT2G35200 unknown protein Lus10036051 17.0 0.7835
AT3G06240 F-box family protein (.1) Lus10013872 18.7 0.8032
AT1G49230 RING/U-box superfamily protein... Lus10006786 22.5 0.7381

Lus10042241 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.