Lus10042263 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30140 156 / 4e-46 UDP-Glycosyltransferase superfamily protein (.1.2)
AT2G30150 141 / 1e-40 UDP-Glycosyltransferase superfamily protein (.1)
AT1G78270 59 / 9e-11 ATUGT85A4 UDP-glucosyl transferase 85A4 (.1)
AT4G15480 59 / 2e-10 UGT84A1 UDP-Glycosyltransferase superfamily protein (.1)
AT1G05675 59 / 2e-10 UDP-Glycosyltransferase superfamily protein (.1)
AT1G22380 58 / 2e-10 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1)
AT1G22360 56 / 2e-09 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2)
AT1G22400 55 / 4e-09 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
AT1G05680 54 / 4e-09 UGT74E2 Uridine diphosphate glycosyltransferase 74E2 (.1)
AT1G22370 54 / 8e-09 ATUGT85A5 UDP-glucosyl transferase 85A5 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042261 217 / 3e-69 AT2G30140 472 / 1e-164 UDP-Glycosyltransferase superfamily protein (.1.2)
Lus10026394 138 / 4e-39 AT2G30140 425 / 3e-146 UDP-Glycosyltransferase superfamily protein (.1.2)
Lus10042262 136 / 1e-38 AT2G30150 375 / 2e-127 UDP-Glycosyltransferase superfamily protein (.1)
Lus10042260 130 / 4e-36 AT2G30140 410 / 3e-139 UDP-Glycosyltransferase superfamily protein (.1.2)
Lus10032218 65 / 1e-12 AT1G22380 564 / 0.0 UDP-glucosyl transferase 85A3 (.1)
Lus10032220 62 / 1e-11 AT1G22380 601 / 0.0 UDP-glucosyl transferase 85A3 (.1)
Lus10042259 61 / 2e-11 AT2G30140 166 / 9e-49 UDP-Glycosyltransferase superfamily protein (.1.2)
Lus10024584 60 / 5e-11 AT1G22400 570 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10013924 58 / 4e-10 AT1G22400 551 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G077200 156 / 5e-46 AT2G30140 478 / 6e-167 UDP-Glycosyltransferase superfamily protein (.1.2)
Potri.001G281900 154 / 2e-45 AT2G30140 478 / 6e-167 UDP-Glycosyltransferase superfamily protein (.1.2)
Potri.001G282100 147 / 2e-42 AT2G30140 475 / 5e-166 UDP-Glycosyltransferase superfamily protein (.1.2)
Potri.001G281800 144 / 2e-41 AT2G30150 467 / 5e-163 UDP-Glycosyltransferase superfamily protein (.1)
Potri.009G077400 139 / 8e-40 AT2G30150 464 / 6e-162 UDP-Glycosyltransferase superfamily protein (.1)
Potri.009G077500 137 / 9e-39 AT2G30140 450 / 5e-156 UDP-Glycosyltransferase superfamily protein (.1.2)
Potri.016G021700 59 / 2e-10 AT1G22400 524 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Potri.016G021200 59 / 2e-10 AT1G22400 523 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Potri.008G062400 58 / 2e-10 AT1G22380 344 / 8e-114 UDP-glucosyl transferase 85A3 (.1)
Potri.016G020800 58 / 2e-10 AT1G22340 446 / 1e-154 UDP-glucosyl transferase 85A7 (.1)
PFAM info
Representative CDS sequence
>Lus10042263 pacid=23154023 polypeptide=Lus10042263 locus=Lus10042263.g ID=Lus10042263.BGIv1.0 annot-version=v1.0
ATGTCTGCCGGACAAGAGAACCCAAGCTCAGCTGGCGGCGGCGACAAGCCCTGCCACATAGTGGCGATGCCTTATCCAGGAAGAGGACACATTAATCAAA
TGATGAACTTCTGCCGCACTCTCTTATCCAAGCACCCCAACATCCTAATCACCTTCGTCCTCACCGAAGAATGGCTCCATTTGCTCGGAGAAGAAACCGC
CAACGGCGGCGGCAACAACAGCAACAACATCCGATTCACCACAATGCCCGACGTCATCCCTTCTGAGCTAGTCCGGGGGAAGGATTTCAAGGAGTTTATC
GAAGCCGTAGGCACCAAGTTGCAAGCCACTTTCGAGAAGGTTCTTGATGGGTTACTACTGGCGCCGCCGGTGAACATCATCATCGCCGACTTGCCGTGGA
TGTGCGATGTAGGAAGTAGCAGGGGAATCCCCGTCGCATCACTGGGGACGATGTCGGCGACTTTTTTCTCCCTGTTCCTTAATTTCGATCTCCTCCGTTA
G
AA sequence
>Lus10042263 pacid=23154023 polypeptide=Lus10042263 locus=Lus10042263.g ID=Lus10042263.BGIv1.0 annot-version=v1.0
MSAGQENPSSAGGGDKPCHIVAMPYPGRGHINQMMNFCRTLLSKHPNILITFVLTEEWLHLLGEETANGGGNNSNNIRFTTMPDVIPSELVRGKDFKEFI
EAVGTKLQATFEKVLDGLLLAPPVNIIIADLPWMCDVGSSRGIPVASLGTMSATFFSLFLNFDLLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G30140 UDP-Glycosyltransferase superf... Lus10042263 0 1
AT2G30150 UDP-Glycosyltransferase superf... Lus10042262 2.0 0.8797
Lus10014817 2.8 0.8880
AT3G18150 RNI-like superfamily protein (... Lus10014142 3.2 0.8427
AT5G52410 unknown protein Lus10026416 10.8 0.8377
AT3G11260 HD WOX5B, WOX5 WUSCHEL related homeobox 5B, W... Lus10040219 14.8 0.8634
AT1G11400 PYM partner of Y14-MAGO (.1.2.3) Lus10002977 32.5 0.8482
AT4G31860 Protein phosphatase 2C family ... Lus10026885 36.7 0.8292
AT4G25810 XTH23, XTR6 xyloglucan endotransglucosylas... Lus10011984 40.8 0.8241
AT2G04240 XERICO RING/U-box superfamily protein... Lus10034407 49.7 0.8424
AT1G31480 SGR2 shoot gravitropism 2 (SGR2) (.... Lus10003520 51.2 0.8292

Lus10042263 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.