Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19615 49 / 2e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026392 [exp] 91 / 3e-24 ND 53 / 6e-10 Lus10031599 [exp] 59 / 3e-12 AT3G19615 47 / 9e-08 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G294800 [exp] 44 / 1e-06 AT3G19615 44 / 6e-07 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042265 pacid=23153736 polypeptide=Lus10042265 locus=Lus10042265.g ID=Lus10042265.BGIv1.0 annot-version=v1.0 ATGGACGGTTTGATTCCATATCTGATCCACGCAATGAAGAGCCACCACCACAGCAAGCCTGCTCACCACCTCCGGAGCTCCAACTCCTTCTCCGAGGGCT CTACTCGAAGCTACCATCTCCTTGTCAGCGGCTCATTGAATGGTGGGTCGTCTCACCGCCGGACCCGCTCCGATTTCCAGCTGCCTCCCACTACTACCGA TTTCTTGGACCAGAAGTCGTCTACAGGTGCAGTACTTGATCATTATAACTCTCCGGCGGGGGTTGTTGGTGCTTTGGTGGTGGTGGTGCCCTCAATTTGG CCGGAAATGGCGGTCGTGGGCAGCTGCAGAAGGAAGCGATGGCCACTACTACTAGCTATGCGGTTGGAAGATGATTGA
AA sequence Show only first row Show all	>Lus10042265 pacid=23153736 polypeptide=Lus10042265 locus=Lus10042265.g ID=Lus10042265.BGIv1.0 annot-version=v1.0 MDGLIPYLIHAMKSHHHSKPAHHLRSSNSFSEGSTRSYHLLVSGSLNGGSSHRRTRSDFQLPPTTTDFLDQKSSTGAVLDHYNSPAGVVGALVVVVPSIW PEMAVVGSCRRKRWPLLLAMRLEDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19615			unknown protein		Lus10042265 [exp]	0	1
AT4G18210		ATPUP10	purine permease 10 (.1)		Lus10030927 [exp]	1.0	0.9551
AT2G31945			unknown protein		Lus10039201 [exp]	4.2	0.9386
					Lus10038520 [exp]	4.7	0.9489
AT5G44390			FAD-binding Berberine family p...		Lus10001965 [exp]	6.2	0.9462
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10040271 [exp]	7.5	0.9408
AT3G10980		SAG20, WI12, AT...	PLAC8 family protein (.1)		Lus10012212 [exp]	7.7	0.9424
AT4G15440		CYP74B2, HPL1	hydroperoxide lyase 1 (.1)		Lus10035289 [exp]	7.7	0.9226
AT2G05940		RIPK	RPM1-induced protein kinase, P...		Lus10033429 [exp]	8.3	0.9268
AT5G25930			Protein kinase family protein ...		Lus10012949 [exp]	10.9	0.8911
AT4G21380		ARK3	receptor kinase 3 (.1)		Lus10033743 [exp]	12.0	0.9437

Compare expression of checked genes

Lus10042265 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.