Lus10042279 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026379 87 / 6e-22 AT3G17930 170 / 1e-52 unknown protein
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10042279 pacid=23154009 polypeptide=Lus10042279 locus=Lus10042279.g ID=Lus10042279.BGIv1.0 annot-version=v1.0
ATGGCTGCTCCCCTCCCAAAGTTTCCAACTTCATGTATTTCACGCCAAGCCAGAGCCATTCCTTCTCTGGGTACTTCAGCTTCGCCATGCTCTCAACTGG
GCTCAACAGTCTGCAGCGTTTTCACAACAGGAAGATCGGTTGCACATGATAGACAGGAAGCTAGACTCTCTTTGAGGAGGCAAAGGTCAACCTTCTTGGT
TTCTGCTTCTGAGAGTGGTTCCTCCTCCAGTGACGGGGATGGTAACTTAGATAAAGGCAAGGCATGTATATTGGGGAAAGCTCGGTTGCTTGATTCTGAC
TGA
AA sequence
>Lus10042279 pacid=23154009 polypeptide=Lus10042279 locus=Lus10042279.g ID=Lus10042279.BGIv1.0 annot-version=v1.0
MAAPLPKFPTSCISRQARAIPSLGTSASPCSQLGSTVCSVFTTGRSVAHDRQEARLSLRRQRSTFLVSASESGSSSSDGDGNLDKGKACILGKARLLDSD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10042279 0 1
AT3G17930 unknown protein Lus10042280 1.0 0.9387
AT5G20220 zinc knuckle (CCHC-type) famil... Lus10036722 2.0 0.9112
AT1G74410 RING/U-box superfamily protein... Lus10021628 3.0 0.9053
AT3G13320 ATCAX2, CAX2 cation exchanger 2 (.1) Lus10006068 3.2 0.8914
AT5G38510 Rhomboid-related intramembrane... Lus10023145 4.0 0.9030
AT5G02180 Transmembrane amino acid trans... Lus10024374 5.9 0.8878
Lus10033476 7.9 0.8847
AT1G54730 Major facilitator superfamily ... Lus10029964 9.4 0.8855
AT4G21190 EMB1417 embryo defective 1417, Pentatr... Lus10039292 10.0 0.8650
AT4G14210 PDE226, PDS3 PIGMENT DEFECTIVE 226, phytoen... Lus10025080 10.1 0.8720

Lus10042279 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.