Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17930 107 / 9e-31 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026379 [exp] 160 / 2e-50 AT3G17930 170 / 1e-52 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G036500 [exp] 105 / 5e-30 AT3G17930 97 / 4e-25 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11460 [flax] [poplar] DUF3007 Protein of unknown function (DUF3007)
Representative CDS sequence Show only first row Show all	>Lus10042280 pacid=23153562 polypeptide=Lus10042280 locus=Lus10042280.g ID=Lus10042280.BGIv1.0 annot-version=v1.0 ATGAAAAGTGGACTAGAGTTCATTGGATTGGACAGCTTCCAAGCAGGGAACATTGTTGAAGTAGTACTGGTTTTGGGGCTAACTGTTGGATGGATATACA CCTATCTCTTCAGAGTCTCCAACAAAGAAATGACTTATGCTCAGCAGCTACGCGACTATGAGTACAAAGTCATGGAGAAACGGTTTGAAAGCTTGACAGA AGCAGAGATAGCAGCATTGATGGAACAAGTTGAAGAAGAGAAGAGGCGCATTGGTGACAAGGACAAGAAGGTTGTTTAG
AA sequence Show only first row Show all	>Lus10042280 pacid=23153562 polypeptide=Lus10042280 locus=Lus10042280.g ID=Lus10042280.BGIv1.0 annot-version=v1.0 MKSGLEFIGLDSFQAGNIVEVVLVLGLTVGWIYTYLFRVSNKEMTYAQQLRDYEYKVMEKRFESLTEAEIAALMEQVEEEKRRIGDKDKKVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G17930			unknown protein		Lus10042280 [exp]	0	1
					Lus10042279 [exp]	1.0	0.9387
AT1G08070		EMB3102, OTP82	ORGANELLE TRANSCRIPT PROCESSIN...		Lus10030053 [exp]	2.0	0.9373
AT2G38570			unknown protein		Lus10014180 [exp]	4.2	0.9244
AT5G19440			NAD(P)-binding Rossmann-fold s...		Lus10026152 [exp]	4.2	0.9207
AT5G38510			Rhomboid-related intramembrane...		Lus10023145 [exp]	4.9	0.9147
AT3G17930			unknown protein		Lus10026379 [exp]	7.5	0.9297
AT4G26555			FKBP-like peptidyl-prolyl cis-...		Lus10027129 [exp]	8.4	0.9250
AT1G07260		UGT71C3	UDP-glucosyl transferase 71C3 ...		Lus10037114 [exp]	9.1	0.8612
AT1G54730			Major facilitator superfamily ...		Lus10029964 [exp]	9.4	0.9041
AT5G20220			zinc knuckle (CCHC-type) famil...		Lus10036722 [exp]	10.4	0.8994

Compare expression of checked genes

Lus10042280 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.