Lus10042301 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 182 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 114 / 2e-31 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G73325 108 / 6e-29 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 86 / 1e-20 ATDR4 drought-repressed 4 (.1)
AT1G72290 52 / 6e-08 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026357 425 / 9e-154 AT1G17860 181 / 6e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039209 363 / 3e-129 AT1G17860 179 / 6e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10022302 363 / 1e-127 AT1G17860 176 / 4e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039210 353 / 1e-125 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013730 348 / 9e-124 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013731 350 / 1e-122 AT1G17860 172 / 5e-53 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013732 335 / 4e-118 AT1G17860 166 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039208 330 / 2e-116 AT1G17860 172 / 2e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10011090 327 / 4e-115 AT1G17860 161 / 4e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G153400 206 / 2e-67 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153466 204 / 7e-67 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153600 199 / 6e-65 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067600 196 / 2e-63 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067900 193 / 3e-62 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 177 / 4e-56 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067800 153 / 1e-46 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G006900 98 / 2e-25 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.004G000400 89 / 1e-21 AT1G73260 91 / 9e-23 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.001G309900 85 / 2e-20 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10042301 pacid=23153741 polypeptide=Lus10042301 locus=Lus10042301.g ID=Lus10042301.BGIv1.0 annot-version=v1.0
ATGAAGGCGACAATGCTACTACTATCTTCATTCATCATAGTCCTAGCCACCTTCACCACAAAACTCCCCGTTTCATCCGCCGCATCTCCAGTCCCCGTCA
CCGACGTGGACGGAACTCCCCTCCGGTCGGGTCTCAAGTACTTCATCCTCCCATCCGTCTCCGGAAACGGCGGAGGAGTGGCTCTAGACCGAACCAAGAC
CAAGAAATGCCCGCTCTCCGTATTCCAAGACGACTACGAGCTGTCCAAGGGTCTCCCAGTAGTTTTCCTTCCCGTCAACTCCGCCAAGCCGGGCTACACC
GTTCAAACGGCCACCGACCTCAACATCGAGTTCACCACCGAGACTGCTTGTGACGAGGCCACGGTGTGGAAGGTGGAGAGCTACGACGACGACGTCAAGC
AGTGGTTCGTAGGGACGGGTGGGATCGAAGGGAAGCCCGGGCCCAGGACGGTGGAGAACTGGTTTAAGATTGCGAAATACGGCGGGAACTACAAGCTTGT
GTATTGTCCTTCTGTGTGCAAGTCGTGTAAAGTCCAGTGTAAGGATGTTGGGGTTTATGAGGATGAAGATGGCAAGAAGAGGCTTGCTCTTACTACTGAT
GATCAGCCGTTTGTTGTTAAGTTCGTCAAGGCTCCTAACAATGCTTAA
AA sequence
>Lus10042301 pacid=23153741 polypeptide=Lus10042301 locus=Lus10042301.g ID=Lus10042301.BGIv1.0 annot-version=v1.0
MKATMLLLSSFIIVLATFTTKLPVSSAASPVPVTDVDGTPLRSGLKYFILPSVSGNGGGVALDRTKTKKCPLSVFQDDYELSKGLPVVFLPVNSAKPGYT
VQTATDLNIEFTTETACDEATVWKVESYDDDVKQWFVGTGGIEGKPGPRTVENWFKIAKYGGNYKLVYCPSVCKSCKVQCKDVGVYEDEDGKKRLALTTD
DQPFVVKFVKAPNNA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17860 Kunitz family trypsin and prot... Lus10042301 0 1
AT1G17860 Kunitz family trypsin and prot... Lus10039163 2.6 0.9896
AT1G17860 Kunitz family trypsin and prot... Lus10013770 3.0 0.9836
AT1G17860 Kunitz family trypsin and prot... Lus10026357 3.5 0.9888
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Lus10030931 4.2 0.9873
AT1G17860 Kunitz family trypsin and prot... Lus10022302 4.9 0.9872
AT1G17860 Kunitz family trypsin and prot... Lus10013730 5.7 0.9841
AT1G21326 VQ motif-containing protein (.... Lus10012286 5.9 0.9869
AT1G17860 Kunitz family trypsin and prot... Lus10039210 7.0 0.9844
AT5G09360 LAC14 laccase 14 (.1) Lus10006157 7.7 0.9847
AT2G19070 SHT spermidine hydroxycinnamoyl tr... Lus10005358 8.2 0.9747

Lus10042301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.