Lus10042316 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21620 251 / 4e-86 RD2 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT3G58450 47 / 1e-06 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT3G11930 44 / 2e-05 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
AT1G44760 39 / 0.0008 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026346 278 / 6e-94 AT2G21620 269 / 5e-90 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10042317 164 / 4e-51 AT2G21620 177 / 2e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10031594 45 / 7e-06 AT1G11360 257 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Lus10033749 45 / 1e-05 AT1G11360 245 / 1e-81 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Lus10039730 43 / 4e-05 AT1G11360 288 / 3e-98 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Lus10006701 39 / 0.0008 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G156200 254 / 3e-87 AT2G21620 256 / 3e-88 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.009G117500 239 / 2e-81 AT2G21620 258 / 5e-89 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.004G156100 217 / 2e-72 AT2G21620 241 / 6e-82 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.006G198200 46 / 2e-06 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Potri.014G122000 45 / 3e-06 AT3G62550 195 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.016G064000 44 / 1e-05 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Potri.005G015200 43 / 3e-05 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.006G092700 41 / 7e-05 AT3G53990 207 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.013G009800 40 / 0.0002 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.002G193800 40 / 0.0003 AT2G47710 213 / 1e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Lus10042316 pacid=23153773 polypeptide=Lus10042316 locus=Lus10042316.g ID=Lus10042316.BGIv1.0 annot-version=v1.0
ATGGAAGTGTTGCAGGAAGAAGAAGAGTACAACTGGAAGGAAGTAAAGTTGCCATCTTTGATCCCTAAAGTTCCAGAACCAGAGTTGGAGAGAGAGAAAG
GGGAAAGGAGGAGAGGCAGAGATATTATCATAGCGATTGATCATGGACCCAACAGCAAGCATGCCTTTGATTGGGCTCTCATCCATTTCTCCAGGCTTGC
CGATACCCTCCATCTTGTTCACGCCGTCTCAAGTGTGAAGAATGATATTGTGGATGAGATGACGCAAGGCCTTATGGAGAAGCTCGCTGTTGAGGCTTTT
CAGGTCTCTATGGTGAAAAGTGTGGCTAGGATAGTGCAAGGAGATGCAGGCAAAGTAATTTGCAAGGAAGCTGAAAGGATTAAGCCTGCAGCTGTTGTGA
TGGGCACTAGAGGCAGAAGCTTAGTTCAGAGTGTGCTGCAAGGAAGTGTGAGTGAGTACTGTTTTCACCACTGCAAAGCTGCACCTGTCATCATTGTTCC
AGGGACAGAAGCTGGAGATGAATCTATGGTATCATGGAACTAA
AA sequence
>Lus10042316 pacid=23153773 polypeptide=Lus10042316 locus=Lus10042316.g ID=Lus10042316.BGIv1.0 annot-version=v1.0
MEVLQEEEEYNWKEVKLPSLIPKVPEPELEREKGERRRGRDIIIAIDHGPNSKHAFDWALIHFSRLADTLHLVHAVSSVKNDIVDEMTQGLMEKLAVEAF
QVSMVKSVARIVQGDAGKVICKEAERIKPAAVVMGTRGRSLVQSVLQGSVSEYCFHHCKAAPVIIVPGTEAGDESMVSWN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21620 RD2 Adenine nucleotide alpha hydro... Lus10042316 0 1
AT1G11340 S-locus lectin protein kinase ... Lus10007604 1.7 0.9498
AT1G65520 PEC11, ECHIC, A... "delta\(3\), delta\(2\)-enoyl ... Lus10005158 3.2 0.9556
AT4G09670 Oxidoreductase family protein ... Lus10005674 4.0 0.9483
AT4G21380 ARK3 receptor kinase 3 (.1) Lus10033743 4.2 0.9579
AT1G16670 Protein kinase superfamily pro... Lus10026207 6.2 0.9177
AT4G28400 Protein phosphatase 2C family ... Lus10008556 7.1 0.9453
AT2G39650 Protein of unknown function (D... Lus10023412 7.9 0.9057
AT1G12600 UDP-N-acetylglucosamine (UAA) ... Lus10029605 8.2 0.9307
AT1G07570 APK1A Protein kinase superfamily pro... Lus10002697 8.4 0.9419
AT2G17705 unknown protein Lus10025950 8.7 0.9286

Lus10042316 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.