Lus10042317 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21620 177 / 3e-56 RD2 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT3G53990 61 / 9e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT3G62550 61 / 1e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G58450 54 / 7e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT3G11930 54 / 8e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
AT3G17020 52 / 2e-08 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT5G14680 52 / 3e-08 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT1G68300 49 / 4e-07 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G03270 47 / 1e-06 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT2G47710 46 / 2e-06 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026346 390 / 2e-137 AT2G21620 269 / 5e-90 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10042316 184 / 6e-59 AT2G21620 284 / 3e-99 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10022602 56 / 1e-09 AT3G53990 225 / 2e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10021501 54 / 2e-09 AT3G53990 144 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10006701 53 / 1e-08 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10021104 53 / 1e-08 AT3G53990 215 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10014545 53 / 1e-08 AT5G14680 295 / 6e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10017207 52 / 2e-08 AT3G53990 217 / 2e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10032142 52 / 2e-08 AT5G14680 296 / 3e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G156100 202 / 5e-66 AT2G21620 241 / 6e-82 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.004G156200 179 / 3e-57 AT2G21620 256 / 3e-88 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.009G117500 175 / 1e-55 AT2G21620 258 / 5e-89 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.006G092700 66 / 1e-13 AT3G53990 207 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.014G122000 65 / 5e-13 AT3G62550 195 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.002G196700 62 / 6e-12 AT3G62550 196 / 6e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.016G104600 61 / 9e-12 AT3G53990 229 / 6e-78 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.006G198200 61 / 2e-11 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Potri.005G015200 60 / 3e-11 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.016G064000 59 / 2e-10 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Lus10042317 pacid=23153479 polypeptide=Lus10042317 locus=Lus10042317.g ID=Lus10042317.BGIv1.0 annot-version=v1.0
ATGGAGGATCCACACTGTAAGAAAAGAGAGAAGCAAACAGCGAAAACACTGGAAACAGTGGAGGAAGATGAGGTGTATGATCATGGTTGGAATGATGAAG
AAGAAGAACAAAGGAAGAGAATATCAGAGCTGGACATGGAAACAGCACAAGGACGAAGAAGAAGAAAAATAGTCAGTGGCGGAGAAGGAGGAAGACACAT
AATTGTAGGGATCGATCATGGACCAAACAGCAAGCATGCTTTCAACTGGGCTCTGCTTCACCTCTGCCGCCAGGCTGACACCCTTCACCTTGTTCATGCC
CTTTCTGATGCAAAGAACAAGCTGCTTTCTGACATGGCTGAAGGGTTGGTGGAGAAGTTTACACTTGAGGCTTTGAGGATGGCTAAAGTGAAGGCAGTGG
GGAGAGTAGTGGAAGGAGAGGCAAGTAAGGTTATTTGCAAGGAAGCAGAGAGGCTAAAACCTGTGGCAGTTGTACTAGGAACCAGAGGGAGATCTCTTTT
CCAAAGTGTGGTGCAAGGAAGTGTCGGGGAGTATTGTTTCCACCACATCAAAGTTCCAGTCGTAATTGTTCCTCTGCAATGTCAGTGTCTAACTACACAA
CCTTTCCTTTATGTTTTCCTCTTTCGGATCTCTGACACTTTCCATGGAAATGACTGTATATGA
AA sequence
>Lus10042317 pacid=23153479 polypeptide=Lus10042317 locus=Lus10042317.g ID=Lus10042317.BGIv1.0 annot-version=v1.0
MEDPHCKKREKQTAKTLETVEEDEVYDHGWNDEEEEQRKRISELDMETAQGRRRRKIVSGGEGGRHIIVGIDHGPNSKHAFNWALLHLCRQADTLHLVHA
LSDAKNKLLSDMAEGLVEKFTLEALRMAKVKAVGRVVEGEASKVICKEAERLKPVAVVLGTRGRSLFQSVVQGSVGEYCFHHIKVPVVIVPLQCQCLTTQ
PFLYVFLFRISDTFHGNDCI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21620 RD2 Adenine nucleotide alpha hydro... Lus10042317 0 1
AT4G33950 ATOST1, P44, SR... SNF1-RELATED PROTEIN KINASE 2.... Lus10040179 1.0 0.9498
AT1G75310 AUL1 auxilin-like 1, auxin-like 1 p... Lus10024270 5.5 0.9300
AT4G39230 NmrA-like negative transcripti... Lus10042311 6.5 0.9387
AT2G26230 uricase / urate oxidase / nodu... Lus10008952 7.9 0.9331
AT3G61710 AtBECLIN1, ATAT... BECLIN1, AUTOPHAGY 6 (.1.2.3) Lus10012632 8.1 0.9262
AT5G45230 Disease resistance protein (TI... Lus10012247 9.4 0.9353
AT4G39830 Cupredoxin superfamily protein... Lus10016808 13.9 0.9315
AT1G06475 unknown protein Lus10004931 15.7 0.9342
AT4G14710 ATARD2 RmlC-like cupins superfamily p... Lus10006617 20.4 0.9249
AT1G65520 PEC11, ECHIC, A... "delta\(3\), delta\(2\)-enoyl ... Lus10005158 21.6 0.9268

Lus10042317 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.