Lus10042330 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036867 105 / 1e-30 AT1G66310 41 / 2e-04 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10024696 61 / 3e-12 AT5G22720 75 / 1e-14 F-box/RNI-like superfamily protein (.1.2)
Lus10024694 59 / 6e-12 ND /
Lus10029357 59 / 2e-11 AT3G28410 79 / 1e-15 F-box/RNI-like superfamily protein (.1)
Lus10002239 48 / 6e-08 AT1G69630 91 / 5e-20 F-box/RNI-like superfamily protein (.1)
Lus10042477 48 / 1e-07 AT1G16930 77 / 2e-15 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10020292 47 / 1e-07 AT1G60410 76 / 9e-15 F-box family protein (.1)
Lus10007058 47 / 1e-07 AT5G56810 77 / 2e-15 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10016192 47 / 2e-07 AT3G26922 68 / 1e-12 F-box/RNI-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G002100 47 / 1e-07 AT4G03220 103 / 5e-24 Protein with RNI-like/FBD-like domains (.1)
Potri.015G011200 36 / 0.001 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1)
PFAM info
Representative CDS sequence
>Lus10042330 pacid=23153933 polypeptide=Lus10042330 locus=Lus10042330.g ID=Lus10042330.BGIv1.0 annot-version=v1.0
ATGTACATTGACTATGCCGATTATTTTATCACCTTCTTCGCCGCTCTGAGTAACGTAACGTCTCTTGCCTTGCGCCAATCTACTCTCAAGATAATGAGTT
GCATTTGCGAATTTCTGGAAAAAGAAGCCTCCCCATTTAAGAGGCTGGAGACTCTGAATTTGGAACCTTACGACGATGCGGACATACCTCGTGGAGTGAT
CGACTACTTCGCCAGAGGCTTTGATATGAATATAACAGTTAAGTATGTTTGA
AA sequence
>Lus10042330 pacid=23153933 polypeptide=Lus10042330 locus=Lus10042330.g ID=Lus10042330.BGIv1.0 annot-version=v1.0
MYIDYADYFITFFAALSNVTSLALRQSTLKIMSCICEFLEKEASPFKRLETLNLEPYDDADIPRGVIDYFARGFDMNITVKYV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10042330 0 1

Lus10042330 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.