Lus10042331 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18150 67 / 6e-13 RNI-like superfamily protein (.1)
AT1G69630 63 / 2e-11 F-box/RNI-like superfamily protein (.1)
AT1G55030 61 / 4e-11 RNI-like superfamily protein (.1)
AT5G02930 61 / 5e-11 F-box/RNI-like superfamily protein (.1)
AT1G16930 61 / 6e-11 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT2G04230 61 / 9e-11 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
AT3G49040 60 / 1e-10 F-box/RNI-like superfamily protein (.1)
AT4G03220 59 / 4e-10 Protein with RNI-like/FBD-like domains (.1)
AT3G51530 58 / 5e-10 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT3G52680 58 / 8e-10 F-box/RNI-like/FBD-like domains-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002239 183 / 1e-56 AT1G69630 91 / 5e-20 F-box/RNI-like superfamily protein (.1)
Lus10024695 177 / 3e-54 AT1G69630 83 / 3e-17 F-box/RNI-like superfamily protein (.1)
Lus10024696 177 / 4e-54 AT5G22720 75 / 1e-14 F-box/RNI-like superfamily protein (.1.2)
Lus10034161 162 / 9e-49 AT1G66310 81 / 8e-17 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10029357 157 / 2e-46 AT3G28410 79 / 1e-15 F-box/RNI-like superfamily protein (.1)
Lus10026190 147 / 1e-42 AT1G16930 80 / 3e-16 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10042477 142 / 6e-41 AT1G16930 77 / 2e-15 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10007058 132 / 8e-37 AT5G56810 77 / 2e-15 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10008502 129 / 1e-35 AT5G44980 69 / 9e-13 F-box/RNI-like/FBD-like domains-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G337200 76 / 4e-16 AT5G22660 86 / 6e-19 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2)
Potri.015G002100 71 / 1e-14 AT4G03220 103 / 5e-24 Protein with RNI-like/FBD-like domains (.1)
Potri.011G104100 71 / 2e-14 AT3G26922 96 / 2e-22 F-box/RNI-like superfamily protein (.1)
Potri.011G024200 69 / 2e-13 AT4G26340 105 / 1e-24 F-box/RNI-like/FBD-like domains-containing protein (.1)
Potri.011G024300 63 / 1e-11 AT3G49030 116 / 3e-28 FBD, F-box and Leucine Rich Repeat domains containing protein (.1.2)
Potri.015G011200 61 / 4e-11 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1)
Potri.011G104300 61 / 7e-11 AT3G26922 91 / 2e-20 F-box/RNI-like superfamily protein (.1)
Potri.011G104200 60 / 1e-10 AT3G26922 97 / 2e-22 F-box/RNI-like superfamily protein (.1)
Potri.011G042900 57 / 1e-09 AT1G61330 226 / 2e-68 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
Potri.015G002001 56 / 4e-09 AT2G04230 59 / 9e-10 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Lus10042331 pacid=23153862 polypeptide=Lus10042331 locus=Lus10042331.g ID=Lus10042331.BGIv1.0 annot-version=v1.0
ATGGTGAAAAACTCTATTGACAGGTTGAGCAATCTTCCAGACTCTATTCTTAATCACATTTTTTCATTCCTCGACACCAAATCTGTCGTTCAAACCTCAG
TACTGTCCAAGCTATGGAAATGCACCTGGAAGCATGTCTCTCTTCTCAGATTCGATAGCTGCTCTTTTCGTTCATATTCGAACTTTGAAAGGTACGTGAA
CAAGGTTTTGTCCCTACGCTCTTCGGTTAATCTGCGTGAGGTTACTTTGATTGATCGTGAAGACTCGAATCTACGACAAGGTAGCTTGTTTTTAAAGGTC
TTAGAATATGCATTTTCCCGTGGTACTCAACATCTAACCATCGACCTGTATAATAAACACTTATGGGACGAAGCCGACTACTCGTTCTCTTATCTATTTG
GCTCAACCGTTTCTCATCATTCCAATCTCAAGTCCTTAGAACTGGACGTGCTCTTCCTCGATGTTGGATTTCGATCTTCCGGTTTCCGGATGTTGAAGAA
GCTAAAACTGGCCACGGCCGTGTTCACATCTGAAGACGAACAAGTCTTCGACTTCTTCTCCGAATTTCCATGTCTCGAGGATCTGACCTGGACGGTGTGC
ATTGCAACGCCGCAACAGGGATAA
AA sequence
>Lus10042331 pacid=23153862 polypeptide=Lus10042331 locus=Lus10042331.g ID=Lus10042331.BGIv1.0 annot-version=v1.0
MVKNSIDRLSNLPDSILNHIFSFLDTKSVVQTSVLSKLWKCTWKHVSLLRFDSCSFRSYSNFERYVNKVLSLRSSVNLREVTLIDREDSNLRQGSLFLKV
LEYAFSRGTQHLTIDLYNKHLWDEADYSFSYLFGSTVSHHSNLKSLELDVLFLDVGFRSSGFRMLKKLKLATAVFTSEDEQVFDFFSEFPCLEDLTWTVC
IATPQQG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18150 RNI-like superfamily protein (... Lus10042331 0 1
AT3G29970 B12D protein (.1) Lus10035132 6.8 0.8367
AT2G14830 Regulator of Vps4 activity in ... Lus10039808 12.0 0.7757
AT1G58170 Disease resistance-responsive ... Lus10017231 12.9 0.8323
AT3G01650 RGLG1 RING domain ligase1 (.1) Lus10003654 14.8 0.7345
AT1G70850 MLP34 MLP-like protein 34 (.1.2.3) Lus10002644 15.2 0.8121
AT1G73990 SPPA1, SPPA signal peptide peptidase (.1) Lus10013333 16.5 0.7966
AT4G12545 Bifunctional inhibitor/lipid-t... Lus10024624 17.2 0.8317
AT3G49601 unknown protein Lus10034691 20.7 0.7898
AT3G06240 F-box family protein (.1) Lus10011015 25.7 0.7474
AT4G08850 Leucine-rich repeat receptor-l... Lus10004046 27.7 0.7797

Lus10042331 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.