Lus10042336 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G24190 88 / 4e-22 SNL3, AtSin3 ARABIDOPSIS THALIANA SIN3 HOMOLOG, SIN3-like 3 (.1.2)
AT1G70060 87 / 1e-21 SNL4 SIN3-like 4 (.1)
AT1G24200 82 / 4e-21 Paired amphipathic helix (PAH2) superfamily protein (.1)
AT1G59890 84 / 9e-21 SNL5 SIN3-like 5 (.1.2.3.4)
AT1G10450 81 / 1e-19 SNL6 SIN3-like 6 (.1)
AT5G15020 77 / 2e-18 SNL2 SIN3-like 2 (.1.2)
AT3G01320 77 / 4e-18 SNL1 SIN3-like 1 (.1.2)
AT1G24230 62 / 5e-13 Paired amphipathic helix (PAH2) superfamily protein (.1)
AT1G70030 57 / 6e-12 Paired amphipathic helix (PAH2) superfamily protein (.1)
AT1G24220 45 / 5e-07 paired amphipathic helix repeat-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010729 101 / 1e-26 AT1G70060 1191 / 0.0 SIN3-like 4 (.1)
Lus10013293 94 / 4e-24 AT1G70060 1454 / 0.0 SIN3-like 4 (.1)
Lus10030817 92 / 2e-23 AT1G70060 1426 / 0.0 SIN3-like 4 (.1)
Lus10014504 79 / 1e-18 AT3G01320 897 / 0.0 SIN3-like 1 (.1.2)
Lus10032181 79 / 1e-18 AT5G15020 1362 / 0.0 SIN3-like 2 (.1.2)
Lus10029218 67 / 2e-14 AT1G24190 270 / 4e-81 ARABIDOPSIS THALIANA SIN3 HOMOLOG, SIN3-like 3 (.1.2)
Lus10030816 62 / 2e-13 AT1G59890 140 / 8e-39 SIN3-like 5 (.1.2.3.4)
Lus10030814 50 / 5e-09 AT1G70060 130 / 2e-35 SIN3-like 4 (.1)
Lus10034645 42 / 3e-06 AT1G24190 107 / 1e-27 ARABIDOPSIS THALIANA SIN3 HOMOLOG, SIN3-like 3 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G192200 97 / 2e-25 AT1G24190 1330 / 0.0 ARABIDOPSIS THALIANA SIN3 HOMOLOG, SIN3-like 3 (.1.2)
Potri.010G038700 92 / 2e-23 AT1G70060 1396 / 0.0 SIN3-like 4 (.1)
Potri.001G350200 82 / 4e-20 AT5G15020 1391 / 0.0 SIN3-like 2 (.1.2)
Potri.005G008200 42 / 1e-06 AT5G15020 66 / 4e-14 SIN3-like 2 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02671 PAH Paired amphipathic helix repeat
Representative CDS sequence
>Lus10042336 pacid=23153823 polypeptide=Lus10042336 locus=Lus10042336.g ID=Lus10042336.BGIv1.0 annot-version=v1.0
ATGGATGATCATGGCTTCGACAATGCTTTTACTAGGTTCAAAGGTGATGATCACGTTTACAAAGCATTTTTAGATATATTGAACATGTACAGGAAGGAAC
ACAAACCCATCGGAGAGGTCTATCAGGAGGTGACTGCACTTTTCAAAGACCACCAAGATCTGCTTCTGGAATTCTCTCACTTTTTGCCACCACCTCTCAG
GCCGGTGATGTTCAACTCCAAACTCTCGAGGCAATCTTAA
AA sequence
>Lus10042336 pacid=23153823 polypeptide=Lus10042336 locus=Lus10042336.g ID=Lus10042336.BGIv1.0 annot-version=v1.0
MDDHGFDNAFTRFKGDDHVYKAFLDILNMYRKEHKPIGEVYQEVTALFKDHQDLLLEFSHFLPPPLRPVMFNSKLSRQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G24190 SNL3, AtSin3 ARABIDOPSIS THALIANA SIN3 HOMO... Lus10042336 0 1
AT5G62440 Protein of unknown function (D... Lus10022837 1.0 0.9900
AT5G42250 Zinc-binding alcohol dehydroge... Lus10021239 3.7 0.9602
AT2G25737 Sulfite exporter TauE/SafE fam... Lus10026025 4.2 0.8760
AT3G23350 ENTH/VHS family protein (.1) Lus10021173 4.9 0.9786
AT1G20330 FRL1, CVP1, SMT... FRILL1, COTYLEDON VASCULAR PAT... Lus10004158 6.0 0.9786
AT1G47710 Serine protease inhibitor (SER... Lus10040926 6.9 0.9219
AT5G41040 HXXXD-type acyl-transferase fa... Lus10005439 6.9 0.9786
AT5G44400 FAD-binding Berberine family p... Lus10027162 7.7 0.9786
AT3G05550 Hypoxia-responsive family prot... Lus10031490 8.5 0.9786
Lus10032805 9.2 0.9786

Lus10042336 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.