Lus10042352 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17380 297 / 3e-104 AP19 associated protein 19 (.1)
AT4G35410 290 / 8e-102 Clathrin adaptor complex small chain family protein (.1.2)
AT1G47830 170 / 1e-54 SNARE-like superfamily protein (.1)
AT2G19790 120 / 5e-35 SNARE-like superfamily protein (.1)
AT3G50860 107 / 2e-29 Clathrin adaptor complex small chain family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026316 328 / 1e-116 AT2G17380 297 / 7e-105 associated protein 19 (.1)
Lus10003641 228 / 4e-77 AT4G35410 251 / 8e-87 Clathrin adaptor complex small chain family protein (.1.2)
Lus10024337 174 / 8e-55 AT1G47830 274 / 5e-95 SNARE-like superfamily protein (.1)
Lus10012924 120 / 1e-34 AT2G19790 280 / 6e-99 SNARE-like superfamily protein (.1)
Lus10035004 113 / 5e-32 AT2G19790 262 / 6e-92 SNARE-like superfamily protein (.1)
Lus10041742 102 / 3e-27 AT3G50860 278 / 6e-97 Clathrin adaptor complex small chain family protein (.1)
Lus10024011 86 / 3e-21 AT3G50860 215 / 3e-72 Clathrin adaptor complex small chain family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G052000 288 / 1e-100 AT2G17380 307 / 6e-109 associated protein 19 (.1)
Potri.002G001800 288 / 2e-100 AT2G17380 278 / 3e-97 associated protein 19 (.1)
Potri.014G079000 282 / 2e-98 AT4G35410 291 / 1e-102 Clathrin adaptor complex small chain family protein (.1.2)
Potri.005G238701 172 / 4e-55 AT1G47830 275 / 8e-97 SNARE-like superfamily protein (.1)
Potri.002G022900 168 / 1e-53 AT1G47830 278 / 6e-98 SNARE-like superfamily protein (.1)
Potri.006G149100 122 / 2e-35 AT2G19790 287 / 1e-101 SNARE-like superfamily protein (.1)
Potri.007G025400 119 / 5e-34 AT3G50860 296 / 1e-104 Clathrin adaptor complex small chain family protein (.1)
Potri.005G122900 116 / 4e-33 AT3G50860 286 / 1e-100 Clathrin adaptor complex small chain family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence
>Lus10042352 pacid=23153505 polypeptide=Lus10042352 locus=Lus10042352.g ID=Lus10042352.BGIv1.0 annot-version=v1.0
ATGGAAGACCGGTTATTGAAGAGAAAAACTTGGAGTGTTGATAGAAATGGAGGGTGGGAGAGCATTTCGCGGAATGATCATTGTCACACTAATCTCACGT
TGTGTTTGCAGATTCACTTCGTTCTTCTCATCAGTCGTCAAGGGAAAGTGAGGCTGACGAAATGGTACTCTCCTTACACCCAGAAGGAAAGATCGAAGGT
CATAAGGGAGCTGAGTGGAATAGTGCTGAATCGGGGTCCGAAGCTCTGCAATTTCGTCGAGTGGAGAGGGTACAGGGTCATTTACAGAAGGTATGCAGGG
TTGTATTTCTGCATGTGCATCGACGAGGCGGACAACGAGTTGGAAGTTCTTGACATCATTCACCACTTTGTCGAAATACTTGATCGATATTTTGGTAGCG
TGTGTGAATTGGACTTGATCTTCAATTTTCACAAGGCTTACTACATACTGGATGAGATTCTGATAGCAGGGGAGTTTCAGGAATCGAGTAAACGAGCTGT
GATAAGATTGATGTCCACGCATGATTCCATGGTGGAGATGGCTAAGGAGGAGGCCACTTCCATTAGCAATATGATTGCCCAAGTCACCAAATAG
AA sequence
>Lus10042352 pacid=23153505 polypeptide=Lus10042352 locus=Lus10042352.g ID=Lus10042352.BGIv1.0 annot-version=v1.0
MEDRLLKRKTWSVDRNGGWESISRNDHCHTNLTLCLQIHFVLLISRQGKVRLTKWYSPYTQKERSKVIRELSGIVLNRGPKLCNFVEWRGYRVIYRRYAG
LYFCMCIDEADNELEVLDIIHHFVEILDRYFGSVCELDLIFNFHKAYYILDEILIAGEFQESSKRAVIRLMSTHDSMVEMAKEEATSISNMIAQVTK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G17380 AP19 associated protein 19 (.1) Lus10042352 0 1
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Lus10033212 5.9 0.9192
AT3G04030 GARP Homeodomain-like superfamily p... Lus10020264 9.2 0.9188
Lus10035048 11.0 0.9152
AT4G35000 APX3 ascorbate peroxidase 3 (.1) Lus10028432 12.3 0.9148
AT5G05570 transducin family protein / WD... Lus10027810 16.1 0.9056
AT2G23970 Class I glutamine amidotransfe... Lus10019964 16.6 0.9129
AT3G04030 GARP Homeodomain-like superfamily p... Lus10002629 18.3 0.9082
AT5G17770 CBR1, ATCBR NADH:cytochrome B5 reductase 1... Lus10034869 18.9 0.8968
AT4G22370 unknown protein Lus10003793 20.1 0.9030
AT4G37445 unknown protein Lus10001408 23.5 0.9035

Lus10042352 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.