Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41905 35 / 0.0008 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026313 [exp] 45 / 2e-07 AT2G41905 62 / 2e-14 unknown protein Lus10040498 [exp] 39 / 4e-05 AT2G41905 64 / 1e-15 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G052001 [exp] 37 / 8e-05 AT3G57690 / ARABINOGALACTAN-PROTEIN 23, arabinogalactan protein 23 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042354 pacid=23153952 polypeptide=Lus10042354 locus=Lus10042354.g ID=Lus10042354.BGIv1.0 annot-version=v1.0 ATGAACATGAAGAAGATCTCCTGCGCCGTCATCTTCGCCGCCGCCTCCATCAGCGCTGTCTTGGCCGCTGAAGAAGCTGCATTGCTCACTCCGTCCGCAA GCCCCGTCACTGCCGCCGGCGCCCCTATGGCCGCCGGAGGTCCTACCGCCGCAGGAGGGCCTGCTGGTGGCCCCACCAGTGATGCCAGCTCCGCATTGCC TGCTTTTGGCACTTTGGTTGGAGCTTCCCTCGTTTCTCTCTTTGGTTACTATTTCCAGTGA
AA sequence Show only first row Show all	>Lus10042354 pacid=23153952 polypeptide=Lus10042354 locus=Lus10042354.g ID=Lus10042354.BGIv1.0 annot-version=v1.0 MNMKKISCAVIFAAASISAVLAAEEAALLTPSASPVTAAGAPMAAGGPTAAGGPAGGPTSDASSALPAFGTLVGASLVSLFGYYFQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G41905			unknown protein		Lus10042354 [exp]	0	1
AT4G15800		RALFL33	ralf-like 33 (.1)		Lus10029893 [exp]	2.2	0.9338
AT2G46640			unknown protein		Lus10030218 [exp]	4.5	0.9149
AT1G72620			alpha/beta-Hydrolases superfam...		Lus10022106 [exp]	21.8	0.9171
AT1G24430			HXXXD-type acyl-transferase fa...		Lus10017469 [exp]	27.3	0.9161
AT2G20760			Clathrin light chain protein (...		Lus10018582 [exp]	33.6	0.9137
AT3G23050	AUX_IAA	AXR2, IAA7	AUXIN RESISTANT 2, indole-3-ac...		Lus10002724 [exp]	35.8	0.8512
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Lus10040265 [exp]	36.7	0.8773
AT5G64330		JK218, RPT3, NP...	ROOT PHOTOTROPISM 3, NON-PHOTO...		Lus10040484 [exp]	38.7	0.9088
					Lus10025807 [exp]	39.2	0.9113
AT4G21480		STP12	sugar transporter protein 12 (...		Lus10040994 [exp]	43.0	0.9094

Compare expression of checked genes

Lus10042354 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.