Lus10042355 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs

No hit found

Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10042355 pacid=23153861 polypeptide=Lus10042355 locus=Lus10042355.g ID=Lus10042355.BGIv1.0 annot-version=v1.0
ATGGCCCATTCGAGCTTCTCAAAGGCAGCTACCCTCTCCGCGGCTGTCCTCGTCGCTTCCCTGGCGGGCCTGGGGTCCGCTCAGGGCATGATGGCCCCCC
CTCCTCCGCTTGTCCTCGTCGCTTCCATGGCCGCCATGGTATCCGCTCAGGACATGATGGCCCCTGCTCCCGCTCCCGCGAGCGTGGCCGGCGCTGGCTT
CTCCGTTCCCGTTTCCGGAGCTGTTGTCGCAGTGTCCCTTGTGGCTTCCCTTATGGGTTTCTTGAAGATGTAG
AA sequence
>Lus10042355 pacid=23153861 polypeptide=Lus10042355 locus=Lus10042355.g ID=Lus10042355.BGIv1.0 annot-version=v1.0
MAHSSFSKAATLSAAVLVASLAGLGSAQGMMAPPPPLVLVASMAAMVSAQDMMAPAPAPASVAGAGFSVPVSGAVVAVSLVASLMGFLKM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10042355 0 1
Lus10026314 1.0 0.9500
AT1G12310 Calcium-binding EF-hand family... Lus10004332 2.0 0.9155
AT5G40150 Peroxidase superfamily protein... Lus10039471 2.8 0.8963
AT2G39770 VTC1, SOZ1, GMP... VITAMIN C DEFECTIVE 1, SENSITI... Lus10040265 3.5 0.9010
AT4G02580 NADH-ubiquinone oxidoreductase... Lus10024851 4.9 0.8710
AT5G17490 GRAS AtRGL3, RGL3 RGA-like protein 3 (.1) Lus10028511 5.2 0.8696
AT1G32860 Glycosyl hydrolase superfamily... Lus10001660 5.5 0.8625
AT4G35320 unknown protein Lus10001621 6.9 0.8746
AT5G40150 Peroxidase superfamily protein... Lus10014517 7.4 0.8667
AT5G62690 TUB2 tubulin beta chain 2 (.1) Lus10002000 7.5 0.8725

Lus10042355 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.