Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52105 75 / 5e-20 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026305 [exp] 127 / 1e-36 AT3G57570 229 / 2e-65 ARM repeat superfamily protein (.1.2) Lus10012208 [exp] 99 / 2e-29 AT3G52105 70 / 5e-18 unknown protein Lus10011321 [exp] 97 / 9e-29 AT3G52105 72 / 1e-18 unknown protein Lus10029521 [exp] 82 / 9e-23 AT3G52105 85 / 8e-24 unknown protein Lus10016415 [exp] 76 / 4e-20 AT3G52105 81 / 3e-22 unknown protein Lus10019704 [exp] 75 / 7e-20 AT3G52105 80 / 6e-22 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G053400 [exp] 95 / 1e-27 AT3G52105 76 / 9e-20 unknown protein Potri.001G267501 [exp] 84 / 1e-23 AT3G52105 87 / 9e-25 unknown protein Potri.009G061800 [exp] 82 / 8e-23 AT3G52105 90 / 1e-25 unknown protein Potri.006G054200 [exp] 81 / 2e-22 AT3G52105 67 / 2e-16 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042363 pacid=23153504 polypeptide=Lus10042363 locus=Lus10042363.g ID=Lus10042363.BGIv1.0 annot-version=v1.0 ATGTTGCAAATTTTCTTTGCGGTGGCCTTCTCATCGGTGCCGTTGACGCTGTACATACCGCCGATTCGTTCCCTAAACCTGTTCGTGGAGACAATGGAGG ATTTGCTCCGTCAGATAGCCATCCAAACGCTAAGGACTTATCCTCGGCTACAGGTCGCCTTCTCTCGACTCATCACCAATCTCGTCTCGTCCCGGTAA
AA sequence Show only first row Show all	>Lus10042363 pacid=23153504 polypeptide=Lus10042363 locus=Lus10042363.g ID=Lus10042363.BGIv1.0 annot-version=v1.0 MLQIFFAVAFSSVPLTLYIPPIRSLNLFVETMEDLLRQIAIQTLRTYPRLQVAFSRLITNLVSSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52105			unknown protein		Lus10042363 [exp]	0	1
AT3G32930			unknown protein		Lus10039189 [exp]	6.5	0.7701
AT3G19290	bZIP	AREB2, ABF4	ABA-RESPONSIVE ELEMENT BINDING...		Lus10002399 [exp]	20.3	0.7388
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Lus10023134 [exp]	32.8	0.7346
AT1G08570		ACHT4	atypical CYS HIS rich thiored...		Lus10002640 [exp]	44.5	0.7244
AT1G08570		ACHT4	atypical CYS HIS rich thiored...		Lus10020254 [exp]	48.4	0.6746
AT1G14290		SBH2	sphingoid base hydroxylase 2 (...		Lus10030481 [exp]	59.6	0.7185
AT4G30780			unknown protein		Lus10035819 [exp]	63.5	0.7202
AT1G11760		MED32	unknown protein		Lus10034758 [exp]	63.8	0.7201
AT5G01075			Glycosyl hydrolase family 35 p...		Lus10018699 [exp]	98.1	0.6696
AT3G27820		ATMDAR4	monodehydroascorbate reductase...		Lus10022260 [exp]	115.7	0.6798

Compare expression of checked genes

Lus10042363 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.