Lus10042368 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G39680 82 / 7e-19 EMB2744 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G16480 81 / 2e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G11290 79 / 1e-17 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G35130 77 / 7e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G14850 76 / 1e-16 MEF11, LOI1 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G39530 74 / 4e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G27610 73 / 1e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G24000 72 / 2e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G33680 72 / 3e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G56570 71 / 5e-15 PGN PENTATRICOPEPTIDE REPEAT PROTEIN FOR GERMINATION ON NaCl, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015225 93 / 1e-22 AT4G18750 990 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10017082 89 / 4e-21 AT1G16480 507 / 3e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10010850 85 / 1e-19 AT5G60020 856 / 0.0 laccase 17 (.1)
Lus10024381 84 / 2e-19 AT3G23330 777 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10006123 81 / 2e-18 AT4G14850 923 / 0.0 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10021232 76 / 1e-16 AT2G33680 818 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10029436 76 / 2e-16 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013991 75 / 3e-16 AT3G57430 632 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040648 75 / 3e-16 AT4G18750 376 / 1e-119 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G053100 123 / 2e-33 AT2G33680 388 / 3e-124 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.012G108000 84 / 3e-19 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.018G145510 83 / 3e-19 AT2G34400 462 / 3e-158 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.016G082200 82 / 7e-19 AT2G37320 602 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G047800 81 / 2e-18 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G086900 80 / 4e-18 AT4G14850 964 / 0.0 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G044700 79 / 1e-17 AT3G22690 582 / 0.0 unknown protein
Potri.018G067500 78 / 3e-17 AT4G13650 590 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G186500 77 / 5e-17 AT3G23330 717 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.012G041200 77 / 6e-17 AT5G16860 1083 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10042368 pacid=23154019 polypeptide=Lus10042368 locus=Lus10042368.g ID=Lus10042368.BGIv1.0 annot-version=v1.0
ATGCATGGATTAGTTACAAAGTTCGGGTTTCTCTATGAAGCTGCTATTGTATCTGTTCTGGTGGAATTCTATGCAAAATGCGGAAAGCTGCAGACTGCCA
GAATAATGGGCAGTTCCAATGCCTTCCTGAGAGAGTTCATGGATAAGAGTGGAGCTGATGACGAAAATCCGCTGGTTTTGTTTAGCCAGTTAAGATCTTA
TGGAAATAAACCAGTTTCTTTTTCTTTGTCGCGACTCTATAGTATATTTGCTACTCAGACTTCTTTAGCCAGCGGGAAAACCCTTCAGGCTTATGCTATC
GAAGCCGGTTATGAGAAGGATGTTTATGTGGCAAACTCCATGGTTACATTGTATGCCAAATGTGGAAGCGTTGAAGACGCTCATCGAATATTCAGTGGCA
TCAATGGCCATGATTTTATGTCATGGAATGCTTTTAGTTTCTGCTTATGGTATTCATGGTAA
AA sequence
>Lus10042368 pacid=23154019 polypeptide=Lus10042368 locus=Lus10042368.g ID=Lus10042368.BGIv1.0 annot-version=v1.0
MHGLVTKFGFLYEAAIVSVLVEFYAKCGKLQTARIMGSSNAFLREFMDKSGADDENPLVLFSQLRSYGNKPVSFSLSRLYSIFATQTSLASGKTLQAYAI
EAGYEKDVYVANSMVTLYAKCGSVEDAHRIFSGINGHDFMSWNAFSFCLWYSW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G39680 EMB2744 EMBRYO DEFECTIVE 2744, Pentatr... Lus10042368 0 1
AT5G47630 MTACP3 mitochondrial acyl carrier pro... Lus10039077 11.3 0.5805
AT2G38660 Amino acid dehydrogenase famil... Lus10034187 66.3 0.4656
AT3G12130 C3HZnF KH domain-containing protein /... Lus10012016 66.6 0.4737
AT2G20710 Tetratricopeptide repeat (TPR)... Lus10005600 78.9 0.4553
AT4G32190 Myosin heavy chain-related pro... Lus10001498 82.9 0.4668
AT5G05220 unknown protein Lus10029015 84.9 0.4627
AT4G24220 5[beta]-StR, 5[... VEIN PATTERNING 1, Δ4,5-s... Lus10027156 111.9 0.4637
AT1G19090 CRK1, RKF2 CYSTEINE-RICH RLK \(RECEPTOR-L... Lus10033389 176.4 0.4186

Lus10042368 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.