Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01170 119 / 4e-37 Protein of unknown function (DUF1138) (.1), Protein of unknown function (DUF1138) (.2) AT4G00860 118 / 9e-37 AT0ZI1, ATOZI1 Arabidopsis thaliana ozone-induced protein 1, Protein of unknown function (DUF1138) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007542 [exp] 135 / 1e-43 AT4G00860 129 / 4e-41 Arabidopsis thaliana ozone-induced protein 1, Protein of unknown function (DUF1138) (.1) Lus10012194 [exp] 122 / 6e-38 AT4G00860 115 / 3e-35 Arabidopsis thaliana ozone-induced protein 1, Protein of unknown function (DUF1138) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G051900 [exp] 128 / 7e-41 AT1G01170 125 / 2e-39 Protein of unknown function (DUF1138) (.1), Protein of unknown function (DUF1138) (.2) Potri.016G055200 [exp] 125 / 2e-39 AT1G01170 120 / 2e-37 Protein of unknown function (DUF1138) (.1), Protein of unknown function (DUF1138) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06592 [flax] [poplar] DUF1138 Protein of unknown function (DUF1138)
Representative CDS sequence Show only first row Show all	>Lus10042373 pacid=23153910 polypeptide=Lus10042373 locus=Lus10042373.g ID=Lus10042373.BGIv1.0 annot-version=v1.0 ATGGCATCCAAGATAACCGGTGCTCTTGCTGGATCGTTTGTTATAGCCTATGTATGTGACAGGGTTGTATCAGATGAGAAAATATTTGGCGGTTCGACTC CAGGTACTGTCTTAAACAAGGGATGGTGGGAGGAAACTGACAAGAAGTTTCAGGCGTGGCCTCGAACTGCTGGTCCACCAGTTGTGATGAATCCCATCAG TCGCCAGAACTTCATTATCAAGTCCCATGACTGA
AA sequence Show only first row Show all	>Lus10042373 pacid=23153910 polypeptide=Lus10042373 locus=Lus10042373.g ID=Lus10042373.BGIv1.0 annot-version=v1.0 MASKITGALAGSFVIAYVCDRVVSDEKIFGGSTPGTVLNKGWWEETDKKFQAWPRTAGPPVVMNPISRQNFIIKSHD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01170			Protein of unknown function (D...		Lus10042373 [exp]	0	1
AT3G58680		MBF1B, ATMBF1B	multiprotein bridging factor 1...		Lus10017945 [exp]	2.4	0.7980
AT5G47740			Adenine nucleotide alpha hydro...		Lus10029567 [exp]	5.1	0.7965
AT4G21105			cytochrome-c oxidases;electron...		Lus10006276 [exp]	7.7	0.7851
AT1G67350			unknown protein		Lus10015785 [exp]	8.7	0.7875
AT5G44710			unknown protein		Lus10001221 [exp]	10.5	0.7264
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Lus10026854 [exp]	13.2	0.7828
AT1G76200			unknown protein		Lus10034571 [exp]	14.0	0.7864
AT3G03490		AtPEX19-1, PEX1...	peroxin 19-1 (.1)		Lus10010463 [exp]	18.2	0.7635
AT4G16570		ATPRMT7	ARABIDOPSIS THALIANA PROTEIN A...		Lus10008510 [exp]	18.3	0.7490
AT3G48890		MSBP2, ATMP2, A...	MEMBRANE STEROID BINDING PROTE...		Lus10038868 [exp]	19.2	0.7159

Compare expression of checked genes

Lus10042373 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.