Lus10042374 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G19840 100 / 8e-28 SAUR-like auxin-responsive protein family (.1)
AT1G75590 100 / 1e-27 SAUR-like auxin-responsive protein family (.1)
AT5G10990 98 / 9e-27 SAUR-like auxin-responsive protein family (.1)
AT4G34750 92 / 1e-24 SAUR-like auxin-responsive protein family (.1.2)
AT2G24400 69 / 2e-15 SAUR-like auxin-responsive protein family (.1)
AT4G34760 59 / 4e-12 SAUR-like auxin-responsive protein family (.1)
AT4G31320 58 / 3e-11 SAUR-like auxin-responsive protein family (.1)
AT1G76190 57 / 3e-11 SAUR-like auxin-responsive protein family (.1)
AT1G56150 56 / 5e-11 SAUR-like auxin-responsive protein family (.1)
AT1G79130 56 / 1e-10 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026297 184 / 7e-61 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Lus10034507 107 / 2e-30 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10012190 104 / 3e-29 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2)
Lus10033161 103 / 8e-29 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1)
Lus10012426 100 / 1e-27 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1)
Lus10007552 87 / 1e-22 AT1G75590 70 / 3e-16 SAUR-like auxin-responsive protein family (.1)
Lus10024322 68 / 2e-15 AT1G75590 152 / 3e-48 SAUR-like auxin-responsive protein family (.1)
Lus10026977 61 / 6e-12 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1)
Lus10017179 57 / 3e-11 AT4G34750 89 / 6e-24 SAUR-like auxin-responsive protein family (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G125900 116 / 3e-34 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1)
Potri.004G164300 114 / 3e-33 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1)
Potri.005G237000 103 / 5e-29 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1)
Potri.002G024500 100 / 7e-28 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1)
Potri.006G278100 67 / 9e-15 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.018G132400 61 / 3e-12 AT3G43120 64 / 2e-13 SAUR-like auxin-responsive protein family (.1)
Potri.010G253800 59 / 1e-11 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 57 / 2e-11 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.008G003900 57 / 3e-11 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1)
Potri.006G070600 57 / 5e-11 AT5G18060 61 / 6e-13 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10042374 pacid=23153682 polypeptide=Lus10042374 locus=Lus10042374.g ID=Lus10042374.BGIv1.0 annot-version=v1.0
ATGTCAAAGTTGAACAAAATCCGCCACATCGTCAGAATCCAGCAGATGCTCAAGCACTGGCGCCACAAAGCCAGAGCCAATAAGTCCACCTTCTCGTCCT
CCTCCTCCCATTCATCATCATCATCATCATCACCCGAAGTCCCCGCCGGACACGTGGCGGTCCACGTCGGAGCGAGCGGCCAGAGATTCGTTGTCCGAGC
CAGGTACCTCAACCATCCGATTTTCCAGAGCATTCTCGCGCGGGCAGAGGAAGAGTACGGATTCAAGAACGACGGGCCGTTGCGGATCCCTTGCGAGGAG
TGGGAGTTTGAGGAGATTCTCCGATTCGTGTCGAGATCGGATTCTAATAATAGTCGATGCTCTTGTTCTTGTAATCATCCGGAGCTAGTCGGCCCTCCTT
CTGGGCGGCCTTTACTCCGTGGTTGA
AA sequence
>Lus10042374 pacid=23153682 polypeptide=Lus10042374 locus=Lus10042374.g ID=Lus10042374.BGIv1.0 annot-version=v1.0
MSKLNKIRHIVRIQQMLKHWRHKARANKSTFSSSSSHSSSSSSSPEVPAGHVAVHVGASGQRFVVRARYLNHPIFQSILARAEEEYGFKNDGPLRIPCEE
WEFEEILRFVSRSDSNNSRCSCSCNHPELVGPPSGRPLLRG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G10990 SAUR-like auxin-responsive pro... Lus10042374 0 1
AT2G06090 Plant self-incompatibility pro... Lus10016350 1.0 0.8291
AT4G17090 CT-BMY, BMY8, B... BETA-AMYLASE 8, BETA-AMYLASE 3... Lus10040134 2.8 0.7935
AT3G10480 NAC ANAC050 NAC domain containing protein ... Lus10040422 4.0 0.7092
AT4G34760 SAUR-like auxin-responsive pro... Lus10026296 13.7 0.6909
AT4G33280 B3 REM16 AP2/B3-like transcriptional fa... Lus10032871 17.0 0.7201
AT1G05970 RNA-binding (RRM/RBD/RNP motif... Lus10017690 20.2 0.6986
AT2G19810 C3HZnF AtOZF1 Oxidation-related Zinc Finger ... Lus10012922 25.3 0.6730
AT3G07680 emp24/gp25L/p24 family/GOLD fa... Lus10006360 32.6 0.6828
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10013728 34.3 0.6679
AT3G09600 MYB LCL5 (LHY-CCA1-... REVEILLE 8, LHY-CCA1-LIKE5, Ho... Lus10019902 34.9 0.6132

Lus10042374 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.