Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34770 137 / 2e-43 SAUR-like auxin-responsive protein family (.1) AT4G34810 110 / 8e-33 SAUR-like auxin-responsive protein family (.1) AT2G21210 105 / 7e-31 SAUR-like auxin-responsive protein family (.1) AT4G38840 103 / 3e-30 SAUR-like auxin-responsive protein family (.1) AT5G18020 102 / 7e-30 SAUR-like auxin-responsive protein family (.1) AT5G18080 102 / 7e-30 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18030 102 / 7e-30 SAUR-like auxin-responsive protein family (.1) AT4G34800 102 / 1e-29 SAUR-like auxin-responsive protein family (.1) AT4G34790 102 / 2e-29 SAUR-like auxin-responsive protein family (.1) AT5G18050 101 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012185 [exp] 128 / 8e-40 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 127 / 2e-39 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 110 / 1e-32 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10009621 [exp] 105 / 8e-31 AT4G38840 115 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10008992 [exp] 105 / 1e-30 AT2G21200 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) Lus10009000 [exp] 104 / 2e-30 AT4G38840 118 / 5e-36 SAUR-like auxin-responsive protein family (.1) Lus10039020 [exp] 103 / 3e-30 AT5G18020 118 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10038193 [exp] 103 / 8e-30 AT4G38840 121 / 3e-37 SAUR-like auxin-responsive protein family (.1) Lus10009620 [exp] 102 / 8e-30 AT4G38840 112 / 5e-34 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G165800 [exp] 140 / 8e-45 AT4G34770 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 115 / 1e-34 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 114 / 2e-34 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 112 / 2e-33 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 108 / 3e-32 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 108 / 5e-32 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.009G127500 [exp] 107 / 1e-31 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G166300 [exp] 107 / 2e-31 AT5G18020 113 / 6e-34 SAUR-like auxin-responsive protein family (.1) Potri.004G165500 [exp] 106 / 2e-31 AT4G34770 115 / 7e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G127600 [exp] 107 / 3e-31 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10042376 pacid=23153854 polypeptide=Lus10042376 locus=Lus10042376.g ID=Lus10042376.BGIv1.0 annot-version=v1.0 ATGGGGATTCAATTACATGGAATCACCAATGCCAAAATGAAGCTTCGGAGGATGCTTTCTGCACACTCCGCGACTGTAATGCCGACGTTGAATTATGTAC CAAAAGGTCATGTTGCAGTGTACGTCGGAGAAAGTCACAGAAAAAGATTCGTGATTCCGATAACATGGCTCAACCATCCTCTGTTTCGAGTCCTTCTAAA TCGAGCCGAGGAAGAGTACGGTTTCTATCATCCGATGGGAGGTCTCACCATCCCTTGCAGTGAAGAATGCTTCATTTCTCTAACTTCAGCTCTGAAAATG TCAGCACAAGTTTGTTCCTGGGAAACATAA
AA sequence Show only first row Show all	>Lus10042376 pacid=23153854 polypeptide=Lus10042376 locus=Lus10042376.g ID=Lus10042376.BGIv1.0 annot-version=v1.0 MGIQLHGITNAKMKLRRMLSAHSATVMPTLNYVPKGHVAVYVGESHRKRFVIPITWLNHPLFRVLLNRAEEEYGFYHPMGGLTIPCSEECFISLTSALKM SAQVCSWET

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34770			SAUR-like auxin-responsive pro...		Lus10042376 [exp]	0	1
AT3G23330			Tetratricopeptide repeat (TPR)...		Lus10019350 [exp]	5.9	0.7508
AT1G19400			Erythronate-4-phosphate dehydr...		Lus10042323 [exp]	11.3	0.7798
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10041541 [exp]	14.6	0.7525
AT1G04420			NAD(P)-linked oxidoreductase s...		Lus10028045 [exp]	14.6	0.7727
AT1G04420			NAD(P)-linked oxidoreductase s...		Lus10003751 [exp]	14.7	0.7658
AT1G09795		HISN1B, ATATP-P...	ATP phosphoribosyl transferase...		Lus10003685 [exp]	17.0	0.7502
AT2G31400		GUN1	genomes uncoupled 1 (.1)		Lus10003657 [exp]	17.5	0.7016
AT2G22600			RNA-binding KH domain-containi...		Lus10002662 [exp]	22.4	0.7088
AT5G63310		NDPK1A, NDPKIAI...	NDP KINASE 1A, NUCLEOSIDE DIPH...		Lus10017931 [exp]	24.3	0.7250
AT2G36230		HISN3, APG10	ALBINO AND PALE GREEN 10, Aldo...		Lus10017042 [exp]	24.7	0.7410

Compare expression of checked genes

Lus10042376 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.