Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34810 117 / 2e-35 SAUR-like auxin-responsive protein family (.1) AT4G34800 102 / 1e-29 SAUR-like auxin-responsive protein family (.1) AT4G38840 102 / 1e-29 SAUR-like auxin-responsive protein family (.1) AT2G21210 96 / 5e-27 SAUR-like auxin-responsive protein family (.1) AT5G18030 94 / 2e-26 SAUR-like auxin-responsive protein family (.1) AT5G18020 93 / 3e-26 SAUR-like auxin-responsive protein family (.1) AT4G34790 94 / 4e-26 SAUR-like auxin-responsive protein family (.1) AT5G18080 92 / 8e-26 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18060 92 / 1e-25 SAUR-like auxin-responsive protein family (.1) AT5G18050 91 / 2e-25 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026294 [exp] 158 / 1e-51 AT4G34810 124 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10042378 [exp] 157 / 2e-51 AT4G34810 129 / 3e-40 SAUR-like auxin-responsive protein family (.1) Lus10012184 [exp] 146 / 8e-47 AT4G34810 125 / 9e-39 SAUR-like auxin-responsive protein family (.1) Lus10007561 [exp] 144 / 6e-46 AT4G34810 125 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10008995 [exp] 103 / 5e-30 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10008999 [exp] 102 / 8e-30 AT4G38840 117 / 7e-36 SAUR-like auxin-responsive protein family (.1) Lus10009001 [exp] 99 / 3e-28 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1) Lus10009628 [exp] 98 / 5e-28 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009623 [exp] 98 / 5e-28 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G164800 [exp] 102 / 2e-29 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 101 / 2e-29 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 101 / 3e-29 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.009G127500 [exp] 101 / 3e-29 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 99 / 4e-28 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165450 [exp] 97 / 8e-28 AT4G38840 129 / 2e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G166100 [exp] 97 / 9e-28 AT2G21210 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165300 [exp] 97 / 2e-27 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 96 / 2e-27 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127600 [exp] 97 / 7e-27 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10042377 pacid=23153973 polypeptide=Lus10042377 locus=Lus10042377.g ID=Lus10042377.BGIv1.0 annot-version=v1.0 ATGGGTATCGGTCGATTCGCTTCAACATTTTTGCTTAATGTTAGGCATAAGATCAATGGGAAGTCTTCCATTCATAATCACCACTGCAGTAGCAGTAGCA GTGAGTGTGTGCCAAAGGGTTATGTTGCAGTTTACGTTGGGGAGGAGATGCAAATGATGATGAAGAGATTTGTCGTTCCAATTTCTTGTTTGAGCAATCC ATCATTCAAGGACTTGCTTACGAGAGCTGAGGAAGAGTTTGGGTTTGATCATCCGATGGGTGGACTCACTATCCCTTGTAAAAAGGATGCCTTTGTTGAT CTTATTGCCTGTCACTTACAGTGA
AA sequence Show only first row Show all	>Lus10042377 pacid=23153973 polypeptide=Lus10042377 locus=Lus10042377.g ID=Lus10042377.BGIv1.0 annot-version=v1.0 MGIGRFASTFLLNVRHKINGKSSIHNHHCSSSSSECVPKGYVAVYVGEEMQMMMKRFVVPISCLSNPSFKDLLTRAEEEFGFDHPMGGLTIPCKKDAFVD LIACHLQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34810			SAUR-like auxin-responsive pro...		Lus10042377 [exp]	0	1
AT2G45050	GATA	GATA2	GATA transcription factor 2 (....		Lus10042879 [exp]	3.5	0.7818
AT1G49230			RING/U-box superfamily protein...		Lus10033515 [exp]	15.0	0.7386
AT3G58060			Cation efflux family protein (...		Lus10029304 [exp]	29.5	0.6898
AT1G26380			FAD-binding Berberine family p...		Lus10038437 [exp]	33.7	0.7342
AT1G66350	GRAS	RGL1	RGA-like 1 (.1)		Lus10017930 [exp]	80.4	0.7048
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Lus10001014 [exp]	80.7	0.7078
AT3G61360			Tetratricopeptide repeat (TPR)...		Lus10020243 [exp]	126.6	0.6686
AT3G60520			unknown protein		Lus10042880 [exp]	152.5	0.6612
AT4G29270			HAD superfamily, subfamily III...		Lus10011140 [exp]	196.6	0.6463

Compare expression of checked genes

Lus10042377 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.