Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34810 129 / 2e-40 SAUR-like auxin-responsive protein family (.1) AT4G34800 108 / 3e-32 SAUR-like auxin-responsive protein family (.1) AT2G21210 106 / 2e-31 SAUR-like auxin-responsive protein family (.1) AT4G38840 105 / 8e-31 SAUR-like auxin-responsive protein family (.1) AT4G34790 100 / 7e-29 SAUR-like auxin-responsive protein family (.1) AT5G18030 99 / 2e-28 SAUR-like auxin-responsive protein family (.1) AT5G18020 98 / 5e-28 SAUR-like auxin-responsive protein family (.1) AT5G18080 96 / 2e-27 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18050 96 / 2e-27 SAUR-like auxin-responsive protein family (.1) AT5G18010 96 / 3e-27 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026294 [exp] 199 / 3e-68 AT4G34810 124 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10007561 [exp] 162 / 2e-53 AT4G34810 125 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10012184 [exp] 160 / 3e-52 AT4G34810 125 / 9e-39 SAUR-like auxin-responsive protein family (.1) Lus10042377 [exp] 157 / 2e-51 AT4G34810 120 / 6e-37 SAUR-like auxin-responsive protein family (.1) Lus10008995 [exp] 104 / 2e-30 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10038193 [exp] 100 / 6e-29 AT4G38840 121 / 3e-37 SAUR-like auxin-responsive protein family (.1) Lus10008999 [exp] 100 / 6e-29 AT4G38840 117 / 7e-36 SAUR-like auxin-responsive protein family (.1) Lus10009001 [exp] 98 / 6e-28 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1) Lus10009628 [exp] 98 / 8e-28 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G127500 [exp] 119 / 3e-36 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G166100 [exp] 113 / 3e-34 AT2G21210 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 108 / 5e-32 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 108 / 5e-32 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 107 / 5e-32 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.009G127600 [exp] 105 / 1e-30 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 103 / 3e-30 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.009G127700 [exp] 103 / 5e-30 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 102 / 2e-29 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 101 / 2e-29 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10042378 pacid=23153467 polypeptide=Lus10042378 locus=Lus10042378.g ID=Lus10042378.BGIv1.0 annot-version=v1.0 ATGGGTATCAGTCGGTTGGCTTCAGCGGTGCTTACTGTCAGGCAAAAGATCAAGGGGAAGTCTCTAATCCATAATAGCAGTAGTACTACTGATCATTGTG TGCCAAAGGGGCATGTTGCAGTTTACGTTGGGGACGAGATGCAAATGATGATGAAGAGATTTGTGGTTCCGATTTCTTGTCTGAGCAATCCTTCATTCAA GGACTTGCTTCGCAGAGCCGAGGAAGAGTTCGGGTTTGATCATCCTATGGGTGGACTCACTATCCCTTGCAGAGAGGATGCCTTCATTGATCTTATTGCC TCTCACTTGCAGTGA
AA sequence Show only first row Show all	>Lus10042378 pacid=23153467 polypeptide=Lus10042378 locus=Lus10042378.g ID=Lus10042378.BGIv1.0 annot-version=v1.0 MGISRLASAVLTVRQKIKGKSLIHNSSSTTDHCVPKGHVAVYVGDEMQMMMKRFVVPISCLSNPSFKDLLRRAEEEFGFDHPMGGLTIPCREDAFIDLIA SHLQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34810			SAUR-like auxin-responsive pro...		Lus10042378 [exp]	0	1
AT2G20520		FLA6	FASCICLIN-like arabinogalactan...		Lus10033651 [exp]	1.4	0.9626
AT1G47480			alpha/beta-Hydrolases superfam...		Lus10021745 [exp]	2.0	0.9408
AT4G28720		YUC8	YUCCA 8, Flavin-binding monoox...		Lus10000494 [exp]	3.5	0.9430
AT3G25070		RIN4	RPM1 interacting protein 4 (.1...		Lus10006451 [exp]	4.6	0.9349
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Lus10024854 [exp]	4.9	0.9545
AT3G50330	bHLH	HEC2, bHLH037	HECATE 2, basic helix-loop-hel...		Lus10042647 [exp]	5.0	0.9373
AT4G18710		DWF12, UCU1, BI...	ULTRACURVATA 1, DWARF 12, BRAS...		Lus10029240 [exp]	6.0	0.8878
AT2G47030		VGDH1	Plant invertase/pectin methyle...		Lus10011760 [exp]	6.3	0.9058
AT4G29140		ADS1	ACTIVATED DISEASE SUSCEPTIBILI...		Lus10012944 [exp]	7.7	0.9158
AT1G70560		CKRC1, WEI8, TA...	WEAK ETHYLENE INSENSITIVE 8, S...		Lus10036846 [exp]	8.9	0.8834

Compare expression of checked genes

Lus10042378 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.