Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G32110 76 / 1e-18 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT4G32080 74 / 3e-18 unknown protein AT4G32090 70 / 3e-16 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT4G32105 68 / 1e-15 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT4G24972 56 / 9e-11 TPD1 tapetum determinant 1 (.1) AT1G32583 56 / 2e-10 unknown protein AT4G32100 53 / 9e-10 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT1G05835 46 / 3e-07 PHD finger protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026289 [exp] 196 / 1e-65 AT4G32090 72 / 5e-17 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10012177 [exp] 129 / 5e-40 AT4G32090 66 / 6e-15 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10007569 [exp] 127 / 3e-39 AT4G32110 64 / 2e-14 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10001911 [exp] 55 / 2e-10 AT1G32583 157 / 5e-50 unknown protein Lus10022437 [exp] 53 / 5e-09 AT5G51140 505 / 1e-177 Pseudouridine synthase family protein (.1.2) Lus10016744 [exp] 52 / 6e-09 AT4G24972 172 / 5e-55 tapetum determinant 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G167900 [exp] 105 / 2e-30 AT4G32090 117 / 7e-35 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Potri.009G129400 [exp] 102 / 3e-29 AT4G32090 117 / 7e-35 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Potri.008G105600 [exp] 65 / 6e-14 AT4G24972 106 / 2e-29 tapetum determinant 1 (.1) Potri.010G246900 [exp] 63 / 1e-13 AT1G32583 104 / 3e-29 unknown protein Potri.006G017600 [exp] 58 / 3e-11 AT1G32583 187 / 5e-61 unknown protein Potri.010G246300 [exp] 55 / 2e-10 AT1G32583 85 / 1e-21 unknown protein Potri.006G257600 [exp] 55 / 2e-10 AT4G32105 77 / 4e-19 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Potri.015G101000 [exp] 52 / 6e-09 AT1G32583 157 / 5e-49 unknown protein Potri.012G102900 [exp] 49 / 4e-08 AT1G32583 160 / 2e-50 unknown protein Potri.002G233000 [exp] 47 / 2e-07 AT1G05835 111 / 2e-32 PHD finger protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042384 pacid=23154026 polypeptide=Lus10042384 locus=Lus10042384.g ID=Lus10042384.BGIv1.0 annot-version=v1.0 ATGGCGGCACTCGCGAATTATCTAGTTGCCATCTTACTTCTTTTGCTTGCCACAAAAGGACACTGTGACTGTGATTTGAACAGCCTGACGATCGGAACGA CGAGGAGCGGAAACACACGACAAGGGGAGACGGAGTGGAACGTACAAGTGACCAACAATTGCGGATGTCCCATCTCCAACCTACTCCTTACCTGCAAAGG ATTCGCCTCGATCGAGCCAGTGAATCCATCTGTGTTTAAGCAAATCGATGGTACTAATTGCCTTGTCAATGGTGGAAGAGCTATTCCTCCCAAAGCCTCT ATCAGATTCTCGTATGCTTGGTCCTCTCCGGCCATTCTTTTCCCTGCTAGCCTCATCGGCCATTGTCCTAATTAA
AA sequence Show only first row Show all	>Lus10042384 pacid=23154026 polypeptide=Lus10042384 locus=Lus10042384.g ID=Lus10042384.BGIv1.0 annot-version=v1.0 MAALANYLVAILLLLLATKGHCDCDLNSLTIGTTRSGNTRQGETEWNVQVTNNCGCPISNLLLTCKGFASIEPVNPSVFKQIDGTNCLVNGGRAIPPKAS IRFSYAWSSPAILFPASLIGHCPN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G32110			Beta-1,3-N-Acetylglucosaminylt...		Lus10042384 [exp]	0	1
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Lus10023446 [exp]	1.7	0.9932
AT2G04160		AIR3	AUXIN-INDUCED IN ROOT CULTURES...		Lus10039087 [exp]	3.2	0.9884
					Lus10012079 [exp]	3.9	0.9869
AT1G74220			unknown protein		Lus10040518 [exp]	4.5	0.9858
AT3G19550			unknown protein		Lus10013901 [exp]	6.3	0.9858
AT1G78980		SRF5	STRUBBELIG-receptor family 5 (...		Lus10034790 [exp]	6.5	0.9835
AT1G50380			Prolyl oligopeptidase family p...		Lus10032964 [exp]	6.5	0.9853
AT3G44970			Cytochrome P450 superfamily pr...		Lus10013060 [exp]	7.5	0.9753
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10025104 [exp]	8.0	0.9432
AT5G64440		ATFAAH	fatty acid amide hydrolase (.1...		Lus10035974 [exp]	8.5	0.9715

Compare expression of checked genes

Lus10042384 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.