Lus10042408 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G10250 155 / 7e-48 ATHSP22.0 HSP20-like chaperones superfamily protein (.1)
AT1G07400 135 / 7e-41 HSP20-like chaperones superfamily protein (.1)
AT1G59860 134 / 2e-40 HSP20-like chaperones superfamily protein (.1)
AT1G53540 126 / 3e-37 HSP20-like chaperones superfamily protein (.1)
AT5G59720 113 / 4e-32 HSP18.2 HSP18.1CI heat shock protein 18.2 (.1)
AT2G29500 110 / 6e-31 HSP20-like chaperones superfamily protein (.1)
AT3G46230 108 / 3e-30 ATHSP17.4 ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4 (.1)
AT5G12020 97 / 8e-26 HSP17.6II 17.6 kDa class II heat shock protein (.1)
AT5G12030 91 / 4e-23 AT-HSP17.6A heat shock protein 17.6A (.1)
AT5G37670 84 / 5e-21 HSP15.7CI HSP20-like chaperones superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026262 358 / 7e-128 AT4G10250 152 / 5e-47 HSP20-like chaperones superfamily protein (.1)
Lus10040560 160 / 1e-49 AT4G10250 200 / 1e-65 HSP20-like chaperones superfamily protein (.1)
Lus10000932 149 / 3e-45 AT4G10250 200 / 2e-65 HSP20-like chaperones superfamily protein (.1)
Lus10009085 119 / 2e-34 AT1G53540 232 / 2e-79 HSP20-like chaperones superfamily protein (.1)
Lus10040723 117 / 1e-33 AT2G29500 219 / 3e-74 HSP20-like chaperones superfamily protein (.1)
Lus10016458 115 / 6e-33 AT2G29500 214 / 3e-72 HSP20-like chaperones superfamily protein (.1)
Lus10040722 106 / 2e-29 AT1G07400 214 / 2e-72 HSP20-like chaperones superfamily protein (.1)
Lus10016457 105 / 9e-29 AT1G07400 216 / 4e-73 HSP20-like chaperones superfamily protein (.1)
Lus10016456 104 / 1e-28 AT1G07400 213 / 8e-72 HSP20-like chaperones superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G089200 145 / 1e-43 AT4G10250 225 / 1e-74 HSP20-like chaperones superfamily protein (.1)
Potri.004G187400 130 / 7e-39 AT1G07400 193 / 7e-64 HSP20-like chaperones superfamily protein (.1)
Potri.001G238700 130 / 1e-38 AT1G53540 195 / 8e-65 HSP20-like chaperones superfamily protein (.1)
Potri.009G039200 127 / 1e-37 AT1G07400 201 / 3e-67 HSP20-like chaperones superfamily protein (.1)
Potri.004G187450 125 / 6e-37 AT2G29500 221 / 5e-75 HSP20-like chaperones superfamily protein (.1)
Potri.019G081250 125 / 9e-37 AT2G29500 182 / 6e-60 HSP20-like chaperones superfamily protein (.1)
Potri.009G049800 124 / 2e-36 AT2G29500 152 / 4e-48 HSP20-like chaperones superfamily protein (.1)
Potri.009G148000 124 / 2e-36 AT2G29500 190 / 7e-63 HSP20-like chaperones superfamily protein (.1)
Potri.009G147900 123 / 8e-36 AT2G29500 193 / 5e-64 HSP20-like chaperones superfamily protein (.1)
Potri.009G049900 120 / 6e-35 AT2G29500 154 / 2e-48 HSP20-like chaperones superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0190 HSP20 PF00011 HSP20 Hsp20/alpha crystallin family
Representative CDS sequence
>Lus10042408 pacid=23153569 polypeptide=Lus10042408 locus=Lus10042408.g ID=Lus10042408.BGIv1.0 annot-version=v1.0
ATGGCGGCCATCCCTACAATACTAGCAATCCTCATAAGCTTAATGGCAACACCTTCAGAATCCCTAATGCCTTACTCAAGGTCACTGTGGGATCACATGA
TGATGCTACCAGAGGACCCATTTCGAATCTTGGAACAATCTCCACTCACCATTCCCAAAGGAATGGAGAGTACTACTACTCTGGCTCTGGCGAGTGCTGA
CTGGAAAGAGACCCCCAAAGCACACTTGATCACCCTCGATATTCCTGGGATGAAGAAGGAGGACGTGAAGATCGAGGTGGAAGAGAACAGAGTGCTTCGG
ATCAGCGGGGAGAGGAAATCGGAACAAGGAGTCGAAGGGGAAATCAAGTGGCACAGAGCTGAGAGGACTTCTGGAAAGTTCTGGAGGCAGTTCAGGCTTC
CTGGGAATGCCGACTTGGATAAGGTGAAAGCTTCCCTGGAAGACGGAGTGCTTACTGTTACTGTGCCGAAGGTTGCTGAGGAGAATAAGAGGCGGGCTAA
GGTTATCAGCATTGCCGCTGAGGGGGAGAAGCATTCCTCTGCTCAGGAGATTGAGGCTACCAAGGCTGCTGCTTGA
AA sequence
>Lus10042408 pacid=23153569 polypeptide=Lus10042408 locus=Lus10042408.g ID=Lus10042408.BGIv1.0 annot-version=v1.0
MAAIPTILAILISLMATPSESLMPYSRSLWDHMMMLPEDPFRILEQSPLTIPKGMESTTTLALASADWKETPKAHLITLDIPGMKKEDVKIEVEENRVLR
ISGERKSEQGVEGEIKWHRAERTSGKFWRQFRLPGNADLDKVKASLEDGVLTVTVPKVAEENKRRAKVISIAAEGEKHSSAQEIEATKAAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G10250 ATHSP22.0 HSP20-like chaperones superfam... Lus10042408 0 1
AT1G53540 HSP20-like chaperones superfam... Lus10040830 3.2 0.8995
AT2G29500 HSP20-like chaperones superfam... Lus10016458 4.2 0.8903
AT4G37450 ATAGP18, AGP18 arabinogalactan protein 18 (.... Lus10011520 7.5 0.8268
AT5G40150 Peroxidase superfamily protein... Lus10014517 7.7 0.8463
AT1G07400 HSP20-like chaperones superfam... Lus10040722 7.9 0.8868
AT1G08450 AtCRT3, PSL1, E... PRIORITY IN SWEET LIFE 1, EMS-... Lus10026849 9.4 0.7896
AT5G40150 Peroxidase superfamily protein... Lus10032170 11.7 0.8127
AT1G07400 HSP20-like chaperones superfam... Lus10016457 14.3 0.8284
AT5G37670 HSP15.7CI HSP20-like chaperones superfam... Lus10020815 15.2 0.8339
AT1G05010 ACO4, EAT1, EFE ethylene forming enzyme, ethyl... Lus10029992 22.6 0.7679

Lus10042408 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.