Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G24960 92 / 5e-23 unknown protein AT4G02210 90 / 4e-22 unknown protein AT3G11310 39 / 0.0003 unknown protein AT5G05800 38 / 0.0007 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026250 [exp] 208 / 1e-64 AT2G24960 750 / 0.0 unknown protein Lus10013421 [exp] 98 / 3e-25 AT4G02210 418 / 1e-144 unknown protein Lus10010304 [exp] 96 / 3e-24 AT4G02210 395 / 1e-135 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G265900 [exp] 112 / 4e-30 AT2G24960 761 / 0.0 unknown protein Potri.002G200600 [exp] 97 / 1e-24 AT4G02210 471 / 1e-163 unknown protein Potri.013G025200 [exp] 87 / 4e-21 AT2G24960 514 / 2e-168 unknown protein Potri.004G172900 [exp] 68 / 2e-14 AT2G24960 96 / 1e-21 unknown protein Potri.002G023800 [exp] 40 / 0.0001 AT2G24960 89 / 2e-19 unknown protein Potri.003G190900 [exp] 40 / 0.0001 AT4G02550 407 / 8e-144 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042421 pacid=23153712 polypeptide=Lus10042421 locus=Lus10042421.g ID=Lus10042421.BGIv1.0 annot-version=v1.0 ATGACTGGCAAGGATGATGATGGTCCTTGTGGAGTAGAGTGGCAACCAGAAATGGATCGTTATTTCATTGACCTGATGTTGGAGGCGTTGCATCAAGGCC TTAAGTATTGTAACAGCTGCAATGAGCTAGCATGGGCTCAAATGGTCGAGTCATTCAACGACAGATTCAGCCATTTGTTGGACAAAAGCATTTTAGAAAC TCGATGTATGGAACTGATGAGAGAGTGTAATGACATCAGCGGTCTTCTCAGTTGCAATGAGTTTACCTGGGATGAGAGCCGAGAAATGTTAGTTGCAGAT GACAAAGTTTGGGAAGCTTATGCTGAGGTGCATTCTTCACTTAGTAGTGGTGCATGA
AA sequence Show only first row Show all	>Lus10042421 pacid=23153712 polypeptide=Lus10042421 locus=Lus10042421.g ID=Lus10042421.BGIv1.0 annot-version=v1.0 MTGKDDDGPCGVEWQPEMDRYFIDLMLEALHQGLKYCNSCNELAWAQMVESFNDRFSHLLDKSILETRCMELMRECNDISGLLSCNEFTWDESREMLVAD DKVWEAYAEVHSSLSSGA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G24960			unknown protein		Lus10042421 [exp]	0	1
AT4G30550		GGP3	gamma-glutamyl peptidase 3, Cl...		Lus10015493 [exp]	1.4	0.9913
					Lus10017955 [exp]	2.0	0.9866
					Lus10009699 [exp]	3.0	0.9695
AT5G17540			HXXXD-type acyl-transferase fa...		Lus10020330 [exp]	3.2	0.9777
AT5G45275			Major facilitator superfamily ...		Lus10033280 [exp]	3.3	0.9664
AT3G28540			P-loop containing nucleoside t...		Lus10007270 [exp]	3.5	0.9789
					Lus10039496 [exp]	4.6	0.9828
AT5G05340			Peroxidase superfamily protein...		Lus10030149 [exp]	6.0	0.9718
					Lus10018837 [exp]	6.9	0.9705
					Lus10003893 [exp]	7.2	0.9640

Compare expression of checked genes

Lus10042421 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.