Gene [FLAX] | FIBexDB

Lus10042425 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TF class	Alias	TAIR10 short description
AT1G80245	109 / 1e-31			Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3)
AT4G00695	102 / 4e-29			unknown protein

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10040637 [exp]	189 / 4e-63	AT1G80245	116 / 9e-35	Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3)
Lus10018276 [exp]	192 / 2e-61	AT3G02910	142 / 4e-41	AIG2-like (avirulence induced gene) family protein (.1)
Lus10018344 [exp]	146 / 1e-46	AT1G80245	86 / 5e-23	Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3)
Lus10026245 [exp]	143 / 3e-45	ND	48 / 3e-08

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.003G149100 [exp]	117 / 1e-34	AT1G80245	91 / 3e-24	Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3)
Potri.001G081300 [exp]	97 / 2e-26	AT1G80245	80 / 5e-20	Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3)

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10042425 pacid=23153993 polypeptide=Lus10042425 locus=Lus10042425.g ID=Lus10042425.BGIv1.0 annot-version=v1.0

ATGGATGGCGTAAACGAGCTTATAGAGGACAACAGGATTGAAGACGTACAGTGGCTATGTTCCCTCTCCGAGTCGGAGCTTGACGTTCTAATCAGCTTGA

AGAAGATGGTGGGTCGACGGGCAACGGCTATTGGTCATGAGGAACTGGCCGAGAAAGTTGGCTTGAAGTTGCTCCGAGCACTTGGGCTAGTTGTCATGGA

GCATTTCAGAGAAAAGATAAAGGATTTGCCGCCAGTACCTGGCATGGACAAGCCTGCAACGTACATAGATGGTTGCAACTTACTAAAGTCTAAGCTTGGG

GACGACTTGAGCATCGAAGAGTTGAAGTTGCACCTTAAGAGGCCGGGTAAAAGGGACAAAAGCACAGGTAGTCAAAGTAGTAGAGATGTCATTGGTGATA

TTTGA

AA sequence

Show only first row Show all

>Lus10042425 pacid=23153993 polypeptide=Lus10042425 locus=Lus10042425.g ID=Lus10042425.BGIv1.0 annot-version=v1.0

MDGVNELIEDNRIEDVQWLCSLSESELDVLISLKKMVGRRATAIGHEELAEKVGLKLLRALGLVVMEHFREKIKDLPPVPGMDKPATYIDGCNLLKSKLG

DDLSIEELKLHLKRPGKRDKSTGSQSSRDVIGDI

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G80245			Spc97 / Spc98 family of spindl...		Lus10042425 [exp]	0	1
AT1G53400			Ubiquitin domain-containing pr...		Lus10015233 [exp]	20.9	0.7301

Lus10042425 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.