Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18660 53 / 3e-10 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1) AT3G55500 52 / 2e-09 ATHEXPALPHA1.7, ATEXP16, ATEXPA16 EXPANSIN 16, expansin A16 (.1) AT4G30380 49 / 1e-08 EXLB2 Barwin-related endoglucanase (.1) AT5G02260 49 / 3e-08 ATHEXPALPHA1.10, ATEXP9, ATEXPA9 expansin A9 (.1) AT5G39290 44 / 2e-06 ATHEXPALPHA1.16, ATEXP26 EXPANSIN 26, expansin A26 (.1) AT5G39270 44 / 2e-06 ATHEXPALPHA1.15, ATEXP22, ATEXPA22 EXPANSIN 22, expansin A22 (.1) AT2G39700 44 / 2e-06 ATHEXPALPHA1.6, ATEXP4, ATEXPA4 expansin A4 (.1) AT2G45110 43 / 4e-06 ATHEXPBETA1.1, ATEXPB4 expansin B4 (.1) AT2G37640 43 / 5e-06 ATHEXPALPHA1.9, ATEXP3, ATEXPA3, EXP3 ARABIDOPSIS THALIANA EXPANSIN A3, EXPANSIN 3, Barwin-like endoglucanases superfamily protein (.1) AT1G65680 41 / 2e-05 ATHEXPBETA1.4, ATEXPB2 expansin B2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020131 [exp] 102 / 4e-29 AT2G18660 59 / 2e-11 plant natriuretic peptide A (.1) Lus10026932 [exp] 102 / 5e-29 AT2G18660 58 / 3e-11 plant natriuretic peptide A (.1) Lus10026930 [exp] 66 / 2e-14 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1) Lus10026931 [exp] 65 / 4e-14 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1) Lus10026929 [exp] 62 / 9e-14 AT2G18660 53 / 1e-09 plant natriuretic peptide A (.1) Lus10020130 [exp] 62 / 2e-13 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1) Lus10020125 [exp] 59 / 2e-12 AT2G18660 63 / 2e-13 plant natriuretic peptide A (.1) Lus10031759 [exp] 58 / 5e-12 AT2G18660 107 / 1e-30 plant natriuretic peptide A (.1) Lus10042435 [exp] 58 / 7e-12 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G098200 [exp] 63 / 3e-14 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1) Potri.006G179300 [exp] 60 / 4e-13 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1) Potri.018G101600 [exp] 60 / 6e-13 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1) Potri.003G218300 [exp] 59 / 1e-12 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1) Potri.006G176300 [exp] 52 / 6e-10 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1) Potri.008G088300 [exp] 45 / 4e-07 AT1G69530 335 / 3e-117 EXPANSIN 1, expansin A1 (.1.2.3.4.5) Potri.014G066300 [exp] 44 / 1e-06 AT1G65680 322 / 2e-111 expansin B2 (.1) Potri.010G167200 [exp] 44 / 2e-06 AT1G69530 335 / 1e-116 EXPANSIN 1, expansin A1 (.1.2.3.4.5) Potri.010G202500 [exp] 43 / 3e-06 AT2G39700 473 / 2e-171 expansin A4 (.1) Potri.019G057500 [exp] 43 / 4e-06 AT2G40610 374 / 2e-132 expansin A8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0199 [flax] [poplar] DPBB PF03330 [flax] [poplar] DPBB_1 Lytic transglycolase
Representative CDS sequence Show only first row Show all	>Lus10042436 pacid=23153996 polypeptide=Lus10042436 locus=Lus10042436.g ID=Lus10042436.BGIv1.0 annot-version=v1.0 ATGGTGGCGATGGTTCCCAACAGTGCTTTCAAAAGTGGGAAAGCGTGTGGGAGCAAGTATGAAGTTACTTGTACCGGCGGAACCAACAATTATCCTTCGC CATGCAAACCAGGGAAGCCGGCGGTCACTGTCACCGTAGCGAATTCATGCAGCGGCGACGATTGCGCCACTTTTACTCTGTCCACCGCCGCTTTTGATGT CGTCGCCAAACATGATGCCGGCCGTATTAACATCTCTTACAAACGGATCAAATGA
AA sequence Show only first row Show all	>Lus10042436 pacid=23153996 polypeptide=Lus10042436 locus=Lus10042436.g ID=Lus10042436.BGIv1.0 annot-version=v1.0 MVAMVPNSAFKSGKACGSKYEVTCTGGTNNYPSPCKPGKPAVTVTVANSCSGDDCATFTLSTAAFDVVAKHDAGRINISYKRIK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G18660		AtPNP-A, PNP-A,...	plant natriuretic peptide A (....		Lus10042436 [exp]	0	1
AT4G12320		CYP706A6	"cytochrome P450, family 706, ...		Lus10032214 [exp]	1.0	0.9410
AT2G20990		SYT1, NTMC2TYPE...	SYNAPTOTAGMIN 1, ARABIDOPSIS T...		Lus10027842 [exp]	2.0	0.8699
AT4G23160		CRK8	cysteine-rich RLK (RECEPTOR-li...		Lus10031577 [exp]	6.6	0.8839
AT4G16160		ATOEP16-2, ATOE...	Mitochondrial import inner mem...		Lus10016878 [exp]	7.5	0.8342
AT1G52190			Major facilitator superfamily ...		Lus10009505 [exp]	7.7	0.6729
					Lus10011314 [exp]	8.1	0.8822
AT5G59380		MBD6, ATMBD6	methyl-CPG-binding domain 6 (....		Lus10029564 [exp]	11.4	0.8588
					Lus10006584 [exp]	13.1	0.7254
AT4G33920			Protein phosphatase 2C family ...		Lus10000700 [exp]	13.4	0.8384
AT1G66950		ABCG39, PDR11, ...	ATP-binding cassette G39, plei...		Lus10006277 [exp]	14.5	0.8384

Compare expression of checked genes

Lus10042436 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.