Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G04520 100 / 4e-28 Nucleic acid-binding, OB-fold-like protein (.1) AT5G35680 96 / 2e-26 Nucleic acid-binding, OB-fold-like protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000920 [exp] 104 / 1e-29 AT2G04520 252 / 1e-87 Nucleic acid-binding, OB-fold-like protein (.1) Lus10020713 [exp] 104 / 1e-29 AT2G04520 169 / 4e-55 Nucleic acid-binding, OB-fold-like protein (.1) Lus10033806 [exp] 103 / 2e-29 AT2G04520 254 / 1e-88 Nucleic acid-binding, OB-fold-like protein (.1) Lus10014627 [exp] 103 / 2e-29 AT2G04520 254 / 1e-88 Nucleic acid-binding, OB-fold-like protein (.1) Lus10029827 [exp] 100 / 3e-28 AT2G04520 168 / 9e-55 Nucleic acid-binding, OB-fold-like protein (.1) Lus10002264 [exp] 100 / 7e-28 AT2G04520 248 / 6e-86 Nucleic acid-binding, OB-fold-like protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G219200 [exp] 104 / 8e-30 AT2G04520 198 / 2e-66 Nucleic acid-binding, OB-fold-like protein (.1) Potri.014G160900 [exp] 104 / 1e-29 AT2G04520 200 / 3e-67 Nucleic acid-binding, OB-fold-like protein (.1) Potri.002G031700 [exp] 87 / 7e-23 AT2G04520 176 / 1e-57 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0021 [flax] [poplar] OB PF01176 [flax] [poplar] eIF-1a Translation initiation factor 1A / IF-1
Representative CDS sequence Show only first row Show all	>Lus10042438 pacid=23153966 polypeptide=Lus10042438 locus=Lus10042438.g ID=Lus10042438.BGIv1.0 annot-version=v1.0 ATGACGAAGAATGAGAAGAGGGGAGAGAAGGAGACGAGTGATCGGCACGGGGAGAGAGATCTCGTATTCGCGGAGGACATCAATCAGCGTTACGCGAAAG TGATGTGTATGGTGGGGAAGAACCACGCGGAAGCCGAGTGCATCGGCTCGACTACTCAACTGTGCTGCATTCCCCGCTCGATGAAGAACAGGGTCCGAAT TTCAAGATACGACATCATACTTGTGAGGCTGAGGGCCTACCATGACGGCAAGGCTGAAGTCATCTTTAGGTACCTGCCCGAAGAGGCTAGACTCCTCAAG TCTTACGGCTATCTTCCTGAGTTTATGGCTATCAATCAGCCCAATGGCAAGGAATTCTGTGCCTTTGAGCAGAATTAA
AA sequence Show only first row Show all	>Lus10042438 pacid=23153966 polypeptide=Lus10042438 locus=Lus10042438.g ID=Lus10042438.BGIv1.0 annot-version=v1.0 MTKNEKRGEKETSDRHGERDLVFAEDINQRYAKVMCMVGKNHAEAECIGSTTQLCCIPRSMKNRVRISRYDIILVRLRAYHDGKAEVIFRYLPEEARLLK SYGYLPEFMAINQPNGKEFCAFEQN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10042438 [exp]	0	1
AT2G32030			Acyl-CoA N-acyltransferases (N...		Lus10039346 [exp]	3.3	0.6747
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10015645 [exp]	4.1	0.7570
AT5G58890	MADS	AGL82	AGAMOUS-like 82 (.1)		Lus10020789 [exp]	6.2	0.6532
AT3G18590		AtENODL5	early nodulin-like protein 5 (...		Lus10016621 [exp]	6.5	0.5668
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10013920 [exp]	7.5	0.7244
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10015241 [exp]	9.2	0.7244
AT5G20260			Exostosin family protein (.1)		Lus10039980 [exp]	10.6	0.7244
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10014126 [exp]	11.8	0.7244
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10013919 [exp]	13.0	0.7065
AT1G18010			Major facilitator superfamily ...		Lus10009413 [exp]	14.7	0.6997

Compare expression of checked genes

Lus10042438 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.