Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44290 133 / 5e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44300 132 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G55260 131 / 8e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G58550 97 / 2e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73890 65 / 5e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 63 / 2e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 60 / 2e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 60 / 3e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 59 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13820 54 / 3e-09 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026220 [exp] 212 / 3e-68 AT2G44300 131 / 6e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10035975 [exp] 118 / 6e-31 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1) Lus10033076 [exp] 88 / 2e-21 AT2G44290 114 / 6e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017749 [exp] 87 / 5e-21 AT2G44290 115 / 3e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 59 / 7e-11 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10006413 [exp] 57 / 7e-10 AT1G27950 137 / 5e-41 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10010572 [exp] 56 / 8e-10 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 56 / 1e-09 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032488 [exp] 56 / 2e-09 AT1G73890 84 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G217000 [exp] 148 / 7e-45 AT1G55260 149 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G008500 [exp] 147 / 1e-44 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232000 [exp] 133 / 5e-39 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G195700 [exp] 131 / 2e-38 AT2G44290 145 / 6e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 61 / 9e-12 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 61 / 2e-11 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G172400 [exp] 57 / 7e-10 AT1G27950 145 / 5e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.015G054000 [exp] 57 / 7e-10 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G053700 [exp] 57 / 7e-10 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050300 [exp] 56 / 1e-09 AT3G22600 117 / 3e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10042449 pacid=23153968 polypeptide=Lus10042449 locus=Lus10042449.g ID=Lus10042449.BGIv1.0 annot-version=v1.0 ATGGAAGGGAGAAAGAAATTTTGGAGGACTAACAGCAGTAGCGCTATCTCTCAGCAGCAGCGGCGGCTGATTTTGGTGGCGATAGTGATCGCGGCGGTGG TCGGAACAGGGACGGCGAACCTGGAGCAGGACAAACAGGAGTGCACGGCGAAATTGATGGGACTGGCTCCTTGCCTGACGTACGTGACCGGTGGATCCAA AGCTCCGACGCTGGATTGTTGCTCCGGTCTGAAACAGGTGATGGAGAAGAGCACAAAGTGCCTTTGCTTGTTAATTAAAGACCGCGACGACCCCGATCTC GGCATCAAAGTCAACATCTCCCTCGCTGCCAGCCTCCCAAACACCTGCCACTCTCCGGCGAATGTCTCCGATTGCGTCAGTATTCTGCATCTAGCACCTA ATTCGGCGGACGCCAAGAAGTTTGACGGACTGGATGACTTAATCTCCAATGGAAACAGTACTACTACTACTCCGACTACCGGTGGTGGTGGTAGCGCCGC CTCTTCCGCAACTTCTGGCGGGAGCTCCGGCGGGAAAAATGAACCTGGGAATGAGAAGAGCGGCGGAGAGGAAGGGATGAAGGGAGGGTACTGGTGGCGG ATGGTGGTGGTGGGGATATGGGGAGTAATGTTGTTCTGCTTCTGA
AA sequence Show only first row Show all	>Lus10042449 pacid=23153968 polypeptide=Lus10042449 locus=Lus10042449.g ID=Lus10042449.BGIv1.0 annot-version=v1.0 MEGRKKFWRTNSSSAISQQQRRLILVAIVIAAVVGTGTANLEQDKQECTAKLMGLAPCLTYVTGGSKAPTLDCCSGLKQVMEKSTKCLCLLIKDRDDPDL GIKVNISLAASLPNTCHSPANVSDCVSILHLAPNSADAKKFDGLDDLISNGNSTTTTPTTGGGGSAASSATSGGSSGGKNEPGNEKSGGEEGMKGGYWWR MVVVGIWGVMLFCF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G55260			Bifunctional inhibitor/lipid-t...		Lus10042449 [exp]	0	1
AT1G05230	HD	HDG2	homeodomain GLABROUS 2 (.1.2.3...		Lus10027175 [exp]	1.7	0.8873
AT2G35760			Uncharacterised protein family...		Lus10038800 [exp]	4.5	0.8048
AT1G11600		CYP77B1	"cytochrome P450, family 77, s...		Lus10018351 [exp]	6.5	0.8465
AT5G02190		EMB24, ATASP38,...	PROMOTION OF CELL SURVIVAL 1, ...		Lus10024375 [exp]	7.3	0.8232
AT2G15480		UGT73B5	UDP-glucosyl transferase 73B5 ...		Lus10026927 [exp]	7.4	0.8254
AT3G48460			GDSL-like Lipase/Acylhydrolase...		Lus10034763 [exp]	9.9	0.8085
AT4G28780			GDSL-like Lipase/Acylhydrolase...		Lus10004770 [exp]	11.3	0.8332
AT2G40475		ASG8	ALTERED SEED GERMINATION 8, un...		Lus10012896 [exp]	12.5	0.7994
					Lus10022823 [exp]	12.6	0.8171
AT3G04290		ATLTL1, LTL1	Li-tolerant lipase 1 (.1)		Lus10003106 [exp]	14.4	0.8424

Compare expression of checked genes

Lus10042449 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.