Lus10042454 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G80690 261 / 5e-88 PPPDE putative thiol peptidase family protein (.1)
AT5G25170 239 / 2e-79 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 226 / 3e-74 PPPDE putative thiol peptidase family protein (.1)
AT1G47740 213 / 2e-68 PPPDE putative thiol peptidase family protein (.1.2)
AT4G31980 221 / 2e-67 unknown protein
AT4G17486 194 / 9e-62 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 189 / 1e-59 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 86 / 1e-19 PPPDE putative thiol peptidase family protein (.1)
AT4G25680 85 / 1e-19 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 51 / 2e-07 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026215 414 / 7e-148 AT1G80690 265 / 8e-90 PPPDE putative thiol peptidase family protein (.1)
Lus10018326 246 / 2e-82 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10017127 245 / 4e-82 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10005341 238 / 3e-79 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1)
Lus10041021 234 / 1e-77 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1)
Lus10032708 206 / 4e-66 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10003951 202 / 7e-65 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004755 200 / 3e-64 AT4G17486 273 / 2e-93 PPPDE putative thiol peptidase family protein (.1.2)
Lus10007844 199 / 5e-64 AT4G17486 277 / 3e-95 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G180400 266 / 2e-90 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
Potri.001G047800 265 / 6e-90 AT1G80690 298 / 2e-103 PPPDE putative thiol peptidase family protein (.1)
Potri.006G261500 244 / 2e-81 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 243 / 4e-81 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.014G042300 216 / 4e-70 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 216 / 4e-70 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.002G134200 214 / 2e-69 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 210 / 6e-68 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 209 / 1e-67 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.003G080300 199 / 1e-63 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10042454 pacid=23153905 polypeptide=Lus10042454 locus=Lus10042454.g ID=Lus10042454.BGIv1.0 annot-version=v1.0
ATGTTCTGTGGGAAAAGCTTTTCAAGGTCAGGAGAAACTAAGAAGGGATCAGTCCCAGTGTTCCTCAATGTATATGACCTCACTCCCATTAATGGCTACG
CTTACTGGGTTGGTCTCGGAGTTTATCATTCTGGTGTTCAAGTTCACAACGTGGAGTATGCGTTTGGGGCACACGAGTACCCAACGACTGGGATATTTGA
AGGCGTGCCAAAGCAATGCGAGGGCTTCACATTCCGCAAGTCAATTCTGATAGGGAAGACTGAGTTGGGTCCATGTGAGGTCAGGAAAGTGATGGAGGAT
TTGGCTCATGAATACAAAGGCAATGCTTACAATTTGATTACCAAGAACTGCAACCATTTCTGCAATGCTGCTTGCCTTAAACTCACTTCCAACCCCATCC
CTAGCTGGGTCAACCGCCTTGCCCGAATCGGATTTCTATGCAATTGTGTGCTTCCTTCGCATATATGTTCGACCAAAGTTCGGCATGATAGCAGCAGGCC
TGAGGAGGATGCCAAGCTGTCTTGTGATGTTGTAATAGTGGACAAGAGTTTGAGAGACGGTGGAACTTATCATGATGATGAGTTCACTACTACTCCCTCT
TCTAAAACTTGCTCGTCTACATCATCTTCTCCCTCTAGTGCTACTACAACTGCCATAACAAGTGGCAATGATGATGAGAATGATCATCAAGTTCGAGGGA
GGAGTAGAACTAGGAGACGACGTCGTGGCGATATCCCCCCTTGTTCCCCTTTGATTACCTCTTCTTCATCACCCTCAGCTGCATCATGA
AA sequence
>Lus10042454 pacid=23153905 polypeptide=Lus10042454 locus=Lus10042454.g ID=Lus10042454.BGIv1.0 annot-version=v1.0
MFCGKSFSRSGETKKGSVPVFLNVYDLTPINGYAYWVGLGVYHSGVQVHNVEYAFGAHEYPTTGIFEGVPKQCEGFTFRKSILIGKTELGPCEVRKVMED
LAHEYKGNAYNLITKNCNHFCNAACLKLTSNPIPSWVNRLARIGFLCNCVLPSHICSTKVRHDSSRPEEDAKLSCDVVIVDKSLRDGGTYHDDEFTTTPS
SKTCSSTSSSPSSATTTAITSGNDDENDHQVRGRSRTRRRRRGDIPPCSPLITSSSSPSAAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G80690 PPPDE putative thiol peptidase... Lus10042454 0 1
AT2G26680 unknown protein Lus10019418 2.0 0.8994
AT1G16860 Ubiquitin-specific protease fa... Lus10034825 2.4 0.9017
AT5G58300 Leucine-rich repeat protein ki... Lus10019113 2.6 0.8674
AT3G09740 ATSYP71, SYP71 syntaxin of plants 71 (.1) Lus10026495 6.3 0.8669
AT2G26680 unknown protein Lus10043275 6.3 0.8797
AT1G78530 Protein kinase superfamily pro... Lus10005569 8.7 0.8490
AT5G52060 ATBAG1 BCL-2-associated athanogene 1 ... Lus10027420 9.5 0.8509
AT2G20840 Secretory carrier membrane pro... Lus10018562 10.8 0.8830
AT1G30630 Coatomer epsilon subunit (.1) Lus10003497 15.0 0.8377
AT2G14835 RING/U-box superfamily protein... Lus10002131 15.2 0.8607

Lus10042454 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.