Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17940 113 / 2e-31 Galactose mutarotase-like superfamily protein (.1) AT5G15140 70 / 5e-15 Galactose mutarotase-like superfamily protein (.1) AT1G29970 61 / 9e-13 RPL18AA 60S ribosomal protein L18A-1 (.1.2.3) AT1G53560 58 / 1e-11 Ribosomal protein L18ae family (.1) AT3G14595 57 / 3e-11 Ribosomal protein L18ae family (.1) AT3G47800 58 / 6e-11 Galactose mutarotase-like superfamily protein (.1) AT5G57060 49 / 2e-08 unknown protein AT4G26060 49 / 3e-08 Ribosomal protein L18ae family (.1) AT1G17080 47 / 1e-07 Ribosomal protein L18ae family (.1) AT1G54217 45 / 3e-07 Ribosomal protein L18ae family (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026181 [exp] 142 / 2e-42 AT3G17940 500 / 3e-179 Galactose mutarotase-like superfamily protein (.1) Lus10000452 [exp] 104 / 3e-28 AT3G17940 436 / 1e-154 Galactose mutarotase-like superfamily protein (.1) Lus10010976 [exp] 103 / 1e-27 AT3G17940 497 / 4e-178 Galactose mutarotase-like superfamily protein (.1) Lus10026180 [exp] 91 / 6e-23 AT1G29970 63 / 7e-12 60S ribosomal protein L18A-1 (.1.2.3) Lus10026193 [exp] 67 / 3e-15 AT1G17080 87 / 3e-22 Ribosomal protein L18ae family (.1) Lus10042474 [exp] 67 / 1e-14 AT1G53560 85 / 1e-20 Ribosomal protein L18ae family (.1) Lus10023611 [exp] 64 / 4e-13 AT3G47800 462 / 5e-164 Galactose mutarotase-like superfamily protein (.1) Lus10015365 [exp] 62 / 2e-12 AT5G15140 403 / 7e-138 Galactose mutarotase-like superfamily protein (.1) Lus10005572 [exp] 59 / 9e-12 AT1G29970 88 / 4e-22 60S ribosomal protein L18A-1 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G045875 [exp] 117 / 4e-33 AT3G17940 555 / 0.0 Galactose mutarotase-like superfamily protein (.1) Potri.017G129300 [exp] 110 / 3e-30 AT3G17940 496 / 1e-177 Galactose mutarotase-like superfamily protein (.1) Potri.017G080100 [exp] 71 / 1e-15 AT3G47800 397 / 3e-138 Galactose mutarotase-like superfamily protein (.1) Potri.017G080200 [exp] 71 / 2e-15 AT3G47800 406 / 9e-142 Galactose mutarotase-like superfamily protein (.1) Potri.004G129700 [exp] 69 / 7e-15 AT3G47800 414 / 5e-145 Galactose mutarotase-like superfamily protein (.1) Potri.017G080000 [exp] 66 / 7e-14 AT5G15140 432 / 3e-150 Galactose mutarotase-like superfamily protein (.1) Potri.012G128800 [exp] 63 / 7e-13 AT3G47800 459 / 1e-162 Galactose mutarotase-like superfamily protein (.1) Potri.001G198700 [exp] 52 / 1e-09 AT4G26060 107 / 3e-31 Ribosomal protein L18ae family (.1) Potri.001G380200 [exp] 52 / 2e-09 AT1G17080 127 / 3e-38 Ribosomal protein L18ae family (.1) Potri.003G044400 [exp] 51 / 2e-09 AT5G57060 103 / 3e-30 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0103 [flax] [poplar] Gal_mutarotase PF01263 [flax] [poplar] Aldose_epim Aldose 1-epimerase
Representative CDS sequence Show only first row Show all	>Lus10042485 pacid=23153850 polypeptide=Lus10042485 locus=Lus10042485.g ID=Lus10042485.BGIv1.0 annot-version=v1.0 ATGCCTTGCTGTGGAATTGGCATTGGCTGGGCCCTGTTCATGCTAGGCTTCATCTTCCCATTTGTATGGATTGGGGGTGGCATCCTTTTGTGTACAAAGT ATGATCGCCGGGAGAAGTCCGGTTATGTTGCTTGCTCTGTTATGGGTCGAGTGGTAAATAGGATCAGGGATGGCAAATTTACCTTAGACGGAGTTGATTA CACTCTGCCTGTCAACAGACCTCCAAACAGTCTCCACGGTGGGAATAAGGGGTTTGACAAGAAGGTGTGGGAGGTTGCTCAACATATCCAAGGCCAGATT CCATCCATAACCTTCAAGTATCACAGTGCTCAAGGAGAAGAAGGTTAG
AA sequence Show only first row Show all	>Lus10042485 pacid=23153850 polypeptide=Lus10042485 locus=Lus10042485.g ID=Lus10042485.BGIv1.0 annot-version=v1.0 MPCCGIGIGWALFMLGFIFPFVWIGGGILLCTKYDRREKSGYVACSVMGRVVNRIRDGKFTLDGVDYTLPVNRPPNSLHGGNKGFDKKVWEVAQHIQGQI PSITFKYHSAQGEEG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G17940			Galactose mutarotase-like supe...		Lus10042485 [exp]	0	1
					Lus10002413 [exp]	6.3	1.0000
					Lus10001326 [exp]	7.1	1.0000
					Lus10014857 [exp]	10.7	1.0000
AT5G04350			Plant self-incompatibility pro...		Lus10029383 [exp]	11.8	1.0000
					Lus10027374 [exp]	12.2	1.0000
AT1G75660		AtXRN3, XRN3	5'-3' exoribonuclease 3 (.1)		Lus10033153 [exp]	12.6	1.0000
					Lus10026755 [exp]	14.1	1.0000
					Lus10022172 [exp]	15.5	1.0000
AT4G17260			Lactate/malate dehydrogenase f...		Lus10028931 [exp]	16.1	1.0000
AT2G19110		ATHMA4, HMA4	ARABIDOPSIS HEAVY METAL ATPASE...		Lus10006956 [exp]	16.4	1.0000

Compare expression of checked genes

Lus10042485 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.