Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G55210 196 / 5e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT5G49040 187 / 8e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13650 180 / 7e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 169 / 1e-53 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13662 157 / 3e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT2G21100 154 / 1e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49030 165 / 4e-47 OVA2 ovule abortion 2, tRNA synthetase class I (I, L, M and V) family protein (.1), tRNA synthetase class I (I, L, M and V) family protein (.2), tRNA synthetase class I (I, L, M and V) family protein (.3) AT5G42510 148 / 2e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 148 / 2e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026176 [exp] 384 / 2e-138 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10029306 [exp] 207 / 2e-68 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10030483 [exp] 196 / 5e-64 AT1G65870 164 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017231 [exp] 195 / 9e-64 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021084 [exp] 164 / 2e-51 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10039561 [exp] 160 / 5e-50 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034479 [exp] 154 / 6e-48 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025065 [exp] 154 / 6e-47 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025064 [exp] 152 / 7e-47 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G216400 [exp] 248 / 2e-84 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216300 [exp] 238 / 2e-80 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.016G061000 [exp] 221 / 7e-74 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G009100 [exp] 216 / 7e-72 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060900 [exp] 204 / 3e-67 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.006G195300 [exp] 202 / 3e-66 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216200 [exp] 200 / 9e-66 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.016G060700 [exp] 200 / 2e-65 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G131000 [exp] 182 / 9e-59 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G023800 [exp] 171 / 2e-54 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [flax] [poplar] AOC_barrel PF03018 [flax] [poplar] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Lus10042488 pacid=23153732 polypeptide=Lus10042488 locus=Lus10042488.g ID=Lus10042488.BGIv1.0 annot-version=v1.0 ATGGCAAAATATCTTCCACTCACAAGCTACCTAATTTCCACCCTCATCTTCTTCTCATCCCTTCAAAACACTTTTTCCCAAGAATTCGTAACACGCCTAA CCCGCAGGCAACTGGGCATGATGAAAAAGGAAAAAATAAGCCACTTCAAGTTCTACTGGCACGACATCTACAGCGCCCCCAACCCGACAGCAATGCCCAT AATCCAGCCGCCGCCTTCATCGGCCAAGTCGGCTCAGACCGGGTTCGGATCCGTGTCGATGATCGACGACCCGATCACGATGGGCCCGGATCTGAAGACG TCAAAGCTGATGGGCCGGGCCCAGGGACTGTACGGAGTGGCTTCGCAGCAGGAAGTGGCGCTGCTGATGGTGATGAACTTCTGGTTCGTGGAAGGGAAGT ACAACGGGAGTTCGATCACGATTCTGGGTAGGAACCCGGTGTTTAACAAAGTGAGGGAGATGCCCATTATCGGAGGGAGTGGGCTGTTCAGGTTCGCCAG GGGATATGCTCATGCTTCCACTCATAACTTCAACTTATCATCTGGGGATGCTTGTGTTGAGTATAATCTCTACGTCATGCATTATTAA
AA sequence Show only first row Show all	>Lus10042488 pacid=23153732 polypeptide=Lus10042488 locus=Lus10042488.g ID=Lus10042488.BGIv1.0 annot-version=v1.0 MAKYLPLTSYLISTLIFFSSLQNTFSQEFVTRLTRRQLGMMKKEKISHFKFYWHDIYSAPNPTAMPIIQPPPSSAKSAQTGFGSVSMIDDPITMGPDLKT SKLMGRAQGLYGVASQQEVALLMVMNFWFVEGKYNGSSITILGRNPVFNKVREMPIIGGSGLFRFARGYAHASTHNFNLSSGDACVEYNLYVMHY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G58170			Disease resistance-responsive ...		Lus10042488 [exp]	0	1
AT4G28030			Acyl-CoA N-acyltransferases (N...		Lus10015504 [exp]	6.2	0.8460
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10017605 [exp]	8.7	0.8358
AT2G20100	bHLH		basic helix-loop-helix (bHLH) ...		Lus10023669 [exp]	9.7	0.8412
AT2G23820			Metal-dependent phosphohydrola...		Lus10015497 [exp]	10.7	0.8389
AT1G21790			TRAM, LAG1 and CLN8 (TLC) lipi...		Lus10018165 [exp]	11.7	0.8238
AT5G45030			Trypsin family protein (.1.2)		Lus10038347 [exp]	12.4	0.8072
AT1G04780			Ankyrin repeat family protein ...		Lus10011743 [exp]	18.1	0.8185
AT4G38430		ATROPGEF1, ROPG...	rho guanyl-nucleotide exchange...		Lus10021234 [exp]	19.4	0.8006
AT4G04720		CPK21	calcium-dependent protein kina...		Lus10020046 [exp]	20.8	0.8068
AT5G59250			Major facilitator superfamily ...		Lus10016505 [exp]	21.2	0.8281

Compare expression of checked genes

Lus10042488 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.