Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14960 104 / 5e-29 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT5G28010 101 / 7e-28 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14930 101 / 7e-28 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT4G23680 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70830 100 / 4e-27 MLP28 MLP-like protein 28 (.1.2.3.4.5) AT1G70840 100 / 5e-27 MLP31 MLP-like protein 31 (.1) AT2G01530 99 / 5e-27 ZCE2, MLP329 \(Zusammen-CA\)-enhanced 2, MLP-like protein 329 (.1) AT1G70850 100 / 2e-26 MLP34 MLP-like protein 34 (.1.2.3) AT1G14950 97 / 2e-26 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14940 97 / 3e-26 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042490 [exp] 261 / 4e-91 AT1G14930 107 / 3e-30 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10033397 [exp] 150 / 4e-47 AT1G14950 121 / 1e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10008930 [exp] 140 / 2e-43 AT5G28010 126 / 2e-37 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10028887 [exp] 140 / 2e-43 AT2G01520 129 / 1e-38 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1) Lus10008932 [exp] 140 / 6e-42 AT4G14060 127 / 1e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10026175 [exp] 117 / 2e-33 AT1G78520 114 / 2e-32 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10020498 [exp] 86 / 1e-21 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10012466 [exp] 83 / 1e-20 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10012742 [exp] 82 / 3e-20 AT1G70830 158 / 6e-50 MLP-like protein 28 (.1.2.3.4.5)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G131100 [exp] 152 / 7e-48 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1) Potri.008G131300 [exp] 135 / 2e-41 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.008G131200 [exp] 129 / 1e-38 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.010G111000 [exp] 98 / 1e-26 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5) Potri.017G051100 [exp] 88 / 1e-22 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1) Potri.017G051200 [exp] 73 / 2e-17 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1) Potri.010G096000 [exp] 62 / 9e-13 AT1G24020 188 / 3e-62 MLP-like protein 423 (.1.2) Potri.004G020000 [exp] 46 / 1e-06 AT1G70880 69 / 3e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.004G020100 [exp] 41 / 8e-05 AT1G70880 58 / 5e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF00407 [flax] [poplar] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Lus10042489 pacid=23153544 polypeptide=Lus10042489 locus=Lus10042489.g ID=Lus10042489.BGIv1.0 annot-version=v1.0 ATGGCAATGAAGGGGAAACTGGAGATAGTGTTTGAATTGAAAGCATCTGCTGATGAGTTTTACAAAGTGTTCAAGCACACAGTCCACCACATCCCCAACC ACACTCCAACCAACATCCATGCTGTTGAACTTCACGAAGGCGAATGGCACACTCCTTCCTGTCTCAAACAATGGACTTATACAATCGATGGGAAGAAGGA AGTGTTGAAGGAGAGGATGGTGCTGGACGACGAGAAAAAGACGGTGACGATAAGCGGTGTGGATGGAGAGCCAATGAAGTTATACAAAGTTTACATTCTT GAGCTTGTGGTTCAGCCCAAAGAGGATGGCAATGGCAGCTGCGTCATCCTTAGCCTCAGCTACGAGAAACTTAACCCGACTTCTCCACCGCCATACAAGT ACCTGGATTTCCTCGAATCTGTTATTCTCGACATCAGCCATGCTGTCCACTCAGCCGCATGA
AA sequence Show only first row Show all	>Lus10042489 pacid=23153544 polypeptide=Lus10042489 locus=Lus10042489.g ID=Lus10042489.BGIv1.0 annot-version=v1.0 MAMKGKLEIVFELKASADEFYKVFKHTVHHIPNHTPTNIHAVELHEGEWHTPSCLKQWTYTIDGKKEVLKERMVLDDEKKTVTISGVDGEPMKLYKVYIL ELVVQPKEDGNGSCVILSLSYEKLNPTSPPPYKYLDFLESVILDISHAVHSAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14960			Polyketide cyclase/dehydrase a...		Lus10042489 [exp]	0	1
AT2G02950		PKS1	phytochrome kinase substrate 1...		Lus10030480 [exp]	1.0	0.9961
AT3G09870			SAUR-like auxin-responsive pro...		Lus10030263 [exp]	2.0	0.9830
AT1G14280		PKS2	phytochrome kinase substrate 2...		Lus10012831 [exp]	2.0	0.9857
AT5G28010			Polyketide cyclase/dehydrase a...		Lus10039891 [exp]	2.4	0.9851
AT1G13570			F-box/RNI-like superfamily pro...		Lus10011048 [exp]	2.6	0.9717
AT1G29930		LHCB1.3, CAB140...	LIGHT-HARVESTING CHLOROPHYLL A...		Lus10007362 [exp]	3.5	0.9751
					Lus10008816 [exp]	4.5	0.9787
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10029575 [exp]	4.7	0.9654
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Lus10023913 [exp]	4.9	0.9645
AT4G17810	C2H2ZnF	ZFP12	C2H2 and C2HC zinc fingers sup...		Lus10040083 [exp]	5.3	0.9626

Compare expression of checked genes

Lus10042489 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.