Lus10042490 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14930 91 / 6e-24 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT4G23680 87 / 3e-22 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT4G23670 86 / 7e-22 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G14940 85 / 1e-21 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
AT1G14950 84 / 4e-21 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G14960 84 / 4e-21 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT2G01530 82 / 1e-20 ZCE2, MLP329 \(Zusammen-CA\)-enhanced 2, MLP-like protein 329 (.1)
AT2G01520 79 / 3e-19 ZCE1, MLP328 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1)
AT4G14060 79 / 3e-19 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT3G26450 77 / 1e-18 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042489 221 / 4e-75 AT1G14960 104 / 5e-29 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10033397 108 / 1e-30 AT1G14950 121 / 1e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10008932 102 / 3e-27 AT4G14060 127 / 1e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10008930 100 / 3e-27 AT5G28010 126 / 2e-37 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10028887 99 / 6e-27 AT2G01520 129 / 1e-38 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1)
Lus10026175 85 / 1e-20 AT1G78520 114 / 2e-32 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10020498 69 / 3e-15 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5)
Lus10012742 67 / 2e-14 AT1G70830 158 / 6e-50 MLP-like protein 28 (.1.2.3.4.5)
Lus10012466 67 / 3e-14 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G131100 117 / 3e-34 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1)
Potri.008G131200 107 / 3e-30 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.008G131300 98 / 2e-26 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.010G111000 75 / 1e-17 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5)
Potri.017G051100 71 / 6e-16 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1)
Potri.017G051200 66 / 2e-14 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Lus10042490 pacid=23153863 polypeptide=Lus10042490 locus=Lus10042490.g ID=Lus10042490.BGIv1.0 annot-version=v1.0
ATGGCAATGAAGGGGAAACTGGAGAGTGTGTTGGGACTGAAAGCATCTGCCGATGAGTTTTACAAAGTGTTCAAGCACACAGTCCACCACATCCCCAACC
ACACTCCAAACAACATCAATGCCGTTGATCTTCACCAAGGCGAATGGCATACTCCTTCCTGTCTCAAACAATGGACTTATACCCTCAATGGGAAGAAGGA
AGTGTTGAAGGAGAAGATGGAGATAGACGACGAGAAGAAGACAGTTACAATAACCGGCGTGGATGGAGACCCAATGAAGTTATACAAAGTGTACGTTGTG
AAGCTTGAGGTTCAGCCCAAAGAGGATGGCAATGGCAGCTGCGTCATCATTACGCTCACCTACGAGAAACTTAACCCAACTTCTCCGCCGGCCTATAAGT
ACCTGGATTTCCTCGAATCTGTTACTCTGGACATCAGCCATTCTGTCTCCTCCGCCGCCGCATGA
AA sequence
>Lus10042490 pacid=23153863 polypeptide=Lus10042490 locus=Lus10042490.g ID=Lus10042490.BGIv1.0 annot-version=v1.0
MAMKGKLESVLGLKASADEFYKVFKHTVHHIPNHTPNNINAVDLHQGEWHTPSCLKQWTYTLNGKKEVLKEKMEIDDEKKTVTITGVDGDPMKLYKVYVV
KLEVQPKEDGNGSCVIITLTYEKLNPTSPPAYKYLDFLESVTLDISHSVSSAAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14930 Polyketide cyclase/dehydrase a... Lus10042490 0 1
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Lus10042095 2.6 0.9028
Lus10010253 3.7 0.9025
Lus10027774 4.6 0.8940
AT5G48905 LCR12 low-molecular-weight cysteine-... Lus10021078 5.0 0.8840
AT1G80245 Spc97 / Spc98 family of spindl... Lus10040637 7.3 0.8049
AT3G57930 unknown protein Lus10031806 8.0 0.8908
AT5G66130 ATRAD17 RADIATION SENSITIVE 17 (.1) Lus10041883 10.7 0.8492
Lus10021851 12.5 0.8810
AT1G02520 MDR8, ABCB11, P... multi-drug resistance 8, ATP-b... Lus10004530 13.5 0.8810
Lus10008791 14.4 0.8810

Lus10042490 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.