Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78520 127 / 2e-39 Carbohydrate-binding X8 domain superfamily protein (.1) AT2G43670 116 / 6e-35 Carbohydrate-binding X8 domain superfamily protein (.1) AT2G43660 92 / 5e-25 Carbohydrate-binding X8 domain superfamily protein (.1.2) AT4G09464 91 / 6e-25 Carbohydrate-binding X8 domain superfamily protein (.1) AT4G09467 91 / 6e-25 Carbohydrate-binding X8 domain superfamily protein (.1) AT4G09465 91 / 6e-25 Carbohydrate-binding X8 domain superfamily protein (.1) AT4G09466 90 / 2e-24 Carbohydrate-binding X8 domain superfamily protein (.1) AT1G66870 89 / 3e-24 Carbohydrate-binding X8 domain superfamily protein (.1) AT4G05430 88 / 2e-23 Carbohydrate-binding X8 domain superfamily protein (.1) AT4G09090 87 / 2e-23 Carbohydrate-binding X8 domain superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026175 [exp] 191 / 8e-63 AT1G78520 114 / 2e-32 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10034607 [exp] 85 / 2e-20 AT2G01630 691 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10040461 [exp] 85 / 3e-20 AT2G16230 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10001516 [exp] 84 / 5e-20 AT2G30933 143 / 3e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2) Lus10031443 [exp] 83 / 1e-19 AT2G30933 143 / 2e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2) Lus10004962 [exp] 83 / 2e-19 AT5G24318 462 / 8e-161 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10007929 [exp] 82 / 2e-19 AT2G01630 730 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10016539 [exp] 82 / 2e-19 AT5G24318 484 / 1e-168 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10005459 [exp] 81 / 2e-19 AT5G24318 341 / 3e-115 O-Glycosyl hydrolases family 17 protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G380600 [exp] 147 / 4e-47 AT1G78520 145 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.011G099000 [exp] 141 / 4e-45 AT1G78520 133 / 4e-42 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.011G101451 [exp] 131 / 5e-41 AT1G78520 124 / 2e-38 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.011G099600 [exp] 129 / 5e-40 AT1G78520 127 / 6e-39 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.011G101351 [exp] 128 / 2e-39 AT1G78520 126 / 1e-38 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.001G351600 [exp] 107 / 3e-31 AT1G78520 119 / 9e-36 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.014G114500 [exp] 87 / 5e-23 AT1G66870 96 / 1e-26 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.001G240000 [exp] 86 / 9e-21 AT5G24318 508 / 2e-178 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.002G007300 [exp] 85 / 3e-20 AT4G29360 339 / 1e-111 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.002G261800 [exp] 85 / 3e-20 AT2G16230 635 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07983 [flax] [poplar] X8 X8 domain
Representative CDS sequence Show only first row Show all	>Lus10042492 pacid=23153710 polypeptide=Lus10042492 locus=Lus10042492.g ID=Lus10042492.BGIv1.0 annot-version=v1.0 ATGGGGCCGGGCCGCTTTCTCTTTATCTTTGCCTTGTACTTCGCTCTGGGTGCAAGTTTCACCATGGGGAACGGACAGAGTGGTAGCATCAGTAGTTGGT GTGTGGCAAAGCCGTCGTCAGACCAAGCGACGTTGTTAGCGAACATAGACTACGCATGCTCGAAAGTGGATTGCCAGATACTGAGGAAAGGATGCCCATG TTCGTATCCTGACACGCTCATCAACCACGCCTCCATCGCCATGAATCTTTACTACCAATCCAAAGGAAGAAACCAGTGCAACTGCGATTTCAGAGGCTCT GCTCTTATTGTCTCCACCAATCCAAGTTATGGTGATTGCATTTACGCCTGA
AA sequence Show only first row Show all	>Lus10042492 pacid=23153710 polypeptide=Lus10042492 locus=Lus10042492.g ID=Lus10042492.BGIv1.0 annot-version=v1.0 MGPGRFLFIFALYFALGASFTMGNGQSGSISSWCVAKPSSDQATLLANIDYACSKVDCQILRKGCPCSYPDTLINHASIAMNLYYQSKGRNQCNCDFRGS ALIVSTNPSYGDCIYA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G78520			Carbohydrate-binding X8 domain...		Lus10042492 [exp]	0	1
AT1G78520			Carbohydrate-binding X8 domain...		Lus10026175 [exp]	1.0	0.8364
AT1G73340			Cytochrome P450 superfamily pr...		Lus10031866 [exp]	6.9	0.7084
AT1G60080			3'-5'-exoribonuclease family p...		Lus10021789 [exp]	15.2	0.7319
AT5G25900		ATKO1, CYP701A3...	CYTOCHROME P450 701 A3, ARABID...		Lus10011667 [exp]	15.9	0.7221
AT5G59510		RTFL5, DVL18	DEVIL 18, ROTUNDIFOLIA like 5 ...		Lus10001569 [exp]	19.1	0.7439
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10017625 [exp]	26.5	0.7074
AT5G41140			Myosin heavy chain-related pro...		Lus10024517 [exp]	29.3	0.7108
AT3G24503		ALDH1A, REF1, A...	REDUCED EPIDERMAL FLUORESCENCE...		Lus10023625 [exp]	38.5	0.7225
AT5G05810		ATL43	RING/U-box superfamily protein...		Lus10023617 [exp]	40.8	0.7039
AT2G02955		MEE12	maternal effect embryo arrest ...		Lus10030476 [exp]	42.0	0.6848

Compare expression of checked genes

Lus10042492 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.