Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17020 213 / 1e-68 ATSRG1, SRG1 senescence-related gene 1 (.1) AT4G25310 205 / 1e-65 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17010 202 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25300 198 / 6e-63 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G78550 189 / 1e-59 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G21420 150 / 4e-44 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 127 / 2e-35 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G05600 123 / 1e-33 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G54000 122 / 2e-33 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G20400 117 / 8e-32 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026173 [exp] 304 / 4e-104 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1) Lus10022292 [exp] 211 / 5e-68 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1) Lus10032574 [exp] 209 / 5e-67 AT4G25300 419 / 2e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011985 [exp] 199 / 8e-63 AT1G17020 367 / 4e-126 senescence-related gene 1 (.1) Lus10011979 [exp] 194 / 5e-61 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1) Lus10011981 [exp] 189 / 4e-59 AT1G17020 375 / 2e-129 senescence-related gene 1 (.1) Lus10011980 [exp] 187 / 1e-58 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1) Lus10015252 [exp] 187 / 2e-58 AT1G17020 375 / 1e-129 senescence-related gene 1 (.1) Lus10030995 [exp] 170 / 8e-52 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G382400 [exp] 233 / 1e-76 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1) Potri.001G355100 [exp] 224 / 3e-73 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1) Potri.001G381700 [exp] 218 / 2e-70 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1) Potri.009G025900 [exp] 202 / 2e-64 AT4G25300 410 / 3e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.001G355200 [exp] 156 / 1e-46 AT1G17020 329 / 3e-111 senescence-related gene 1 (.1) Potri.009G022800 [exp] 145 / 2e-42 AT1G17020 302 / 6e-101 senescence-related gene 1 (.1) Potri.010G201000 [exp] 144 / 6e-42 AT3G21420 290 / 5e-96 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G023600 [exp] 138 / 1e-39 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G200900 [exp] 134 / 5e-38 AT3G21420 288 / 4e-95 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G062500 [exp] 129 / 4e-36 AT5G20400 432 / 2e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10042493 pacid=23153472 polypeptide=Lus10042493 locus=Lus10042493.g ID=Lus10042493.BGIv1.0 annot-version=v1.0 ATGGAAGAAAAAAAAAAGTATTGGCAAAGAGAGGAAGAAGTCGAAGGTTTCGGACAAGCATTCGTGGTCTCCGAGGAACAGAAGCTCGATTGGGCCGACC TATTCTTCCTCGTCACGCAGCCTCCTCACGAGAGAAAGCCTCACTTGTTTCCAAAGCTTCCCCTGCCTCTAAGAGAGACCTTGGAGGTATACTCTATGGA GCTTAAAAACACAGCAATGGAGATCTTGGTTCAAATGGCCAAAGCACTAAAAATGGACGAAAATGAGATGACACAAGTGTTTGAAAATGGACATCAATCA ATGAGGATGAACTATTACCCACCGTGCCCGCAACCGAATAAGGTCATTGGGCTCACTCCGCATTCTGACGCCACGGGCTTAACCATCCTTCTCCAGCTCA ACCAAGTCCAAGGCCTCCAGATCAAGAAACATGGCAACTGGGTTACTGTGAAACCCCTCCCTAATGCCTTCATCATCAACATTGGCGGAGAAAGAAAGGT TTGCGTGTGCGACGTTCTTTCCGCCGAGCTACAAGAAAGAGATAGGACCCGCCGAAAGCTTGATTACTGA
AA sequence Show only first row Show all	>Lus10042493 pacid=23153472 polypeptide=Lus10042493 locus=Lus10042493.g ID=Lus10042493.BGIv1.0 annot-version=v1.0 MEEKKKYWQREEEVEGFGQAFVVSEEQKLDWADLFFLVTQPPHERKPHLFPKLPLPLRETLEVYSMELKNTAMEILVQMAKALKMDENEMTQVFENGHQS MRMNYYPPCPQPNKVIGLTPHSDATGLTILLQLNQVQGLQIKKHGNWVTVKPLPNAFIINIGGERKVCVCDVLSAELQERDRTRRKLDY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Lus10042493 [exp]	0	1
AT1G33030			O-methyltransferase family pro...		Lus10009442 [exp]	1.0	0.9539
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Lus10038141 [exp]	4.0	0.8898
AT1G21000			PLATZ transcription factor fam...		Lus10023411 [exp]	5.3	0.9039
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10001640 [exp]	10.9	0.8895
AT5G06720		ATPA2	peroxidase 2 (.1)		Lus10004163 [exp]	11.0	0.9048
AT5G05340			Peroxidase superfamily protein...		Lus10029062 [exp]	12.6	0.9090
AT1G55850		ATCSLE1	cellulose synthase like E1 (.1...		Lus10016625 [exp]	19.7	0.9030
AT1G01490			Heavy metal transport/detoxifi...		Lus10028762 [exp]	22.7	0.8921
AT5G39150			RmlC-like cupins superfamily p...		Lus10003116 [exp]	23.3	0.8953
AT3G61980			serine protease inhibitor, Kaz...		Lus10010285 [exp]	23.7	0.8883

Compare expression of checked genes

Lus10042493 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.