Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032865 [exp] 74 / 2e-18 AT2G01050 40 / 9e-05 zinc ion binding;nucleic acid binding (.1) Lus10021739 [exp] 54 / 3e-10 ND / Lus10004431 [exp] 53 / 1e-09 ND / Lus10027005 [exp] 47 / 3e-08 ND 36 / 9e-04 Lus10036275 [exp] 47 / 9e-08 ND / Lus10010034 [exp] 47 / 2e-07 ND / Lus10009076 [exp] 45 / 3e-07 ND / Lus10037828 [exp] 45 / 6e-07 ND / Lus10034032 [exp] 45 / 2e-06 AT1G06620 374 / 1e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042500 pacid=23153518 polypeptide=Lus10042500 locus=Lus10042500.g ID=Lus10042500.BGIv1.0 annot-version=v1.0 ATGCAACGGCAGCTTGATGCGCTGCAGTTAACAGCGCCGGAGAACGAAGCTCTCCAATTCGACCCACCCACCACGCAGATCCGGACAACGAACTACACAC TATGCATAGTCGGATCGTTGCTGACTACCAGCCCGTACAATTTCAACGTCATGAAAACTACGATGGCAAAGATTTGGCAACCTGGGATGGGGATGGCGAC AGAAGACATTGGAAATCACATCATCCTCTTCAGTTTCTACAACAACATTGATCTCCGCTGGGTTGTCGATGCAGGACCGTGGCTTTTTGATCGTTTTCAC ATTGTTCTTGACGAGTGA
AA sequence Show only first row Show all	>Lus10042500 pacid=23153518 polypeptide=Lus10042500 locus=Lus10042500.g ID=Lus10042500.BGIv1.0 annot-version=v1.0 MQRQLDALQLTAPENEALQFDPPTTQIRTTNYTLCIVGSLLTTSPYNFNVMKTTMAKIWQPGMGMATEDIGNHIILFSFYNNIDLRWVVDAGPWLFDRFH IVLDE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10042500 [exp]	0	1
					Lus10007176 [exp]	1.4	0.8184
AT1G11340			S-locus lectin protein kinase ...		Lus10005136 [exp]	6.9	0.7085
AT3G04950			unknown protein		Lus10022395 [exp]	10.7	0.6161
					Lus10017181 [exp]	12.5	0.6493
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10009928 [exp]	15.9	0.6510
					Lus10011637 [exp]	18.8	0.6765
AT5G18020			SAUR-like auxin-responsive pro...		Lus10027690 [exp]	23.7	0.6470
AT3G02210		COBL1	COBRA-like protein 1 precursor...		Lus10034379 [exp]	28.2	0.6415
AT1G13290	C2H2ZnF	WIP6, DOT5	WIP domain protein 6, DEFECTIV...		Lus10035044 [exp]	57.7	0.5898
AT1G64160			Disease resistance-responsive ...		Lus10028749 [exp]	70.9	0.5420

Compare expression of checked genes

Lus10042500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.