Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G26150 55 / 9e-09 GATA GATA22, CGA1, GNL GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) AT5G56860 55 / 1e-08 GATA GATA21, GNC GATA, nitrate-inducible, carbon metabolism-involved, GATA TRANSCRIPTION FACTOR 21, GATA type zinc finger transcription factor family protein (.1) AT3G06740 52 / 1e-08 GATA GATA15 GATA transcription factor 15 (.1) AT3G54810 53 / 3e-08 GATA GATA8, BME3, BME3-ZF GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) AT2G18380 52 / 4e-08 GATA GATA20, HANL1 hanaba taranu like 1, GATA transcription factor 20 (.1) AT3G20750 52 / 5e-08 GATA GATA29 GATA transcription factor 29 (.1) AT4G16141 52 / 5e-08 GATA GATA type zinc finger transcription factor family protein (.1) AT5G49300 50 / 6e-08 GATA GATA16 GATA transcription factor 16 (.1) AT1G08010 51 / 1e-07 GATA GATA11 GATA transcription factor 11 (.1.2) AT1G08000 51 / 1e-07 GATA GATA10 GATA transcription factor 10 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038150 [exp] 55 / 2e-09 AT3G20750 62 / 2e-12 GATA transcription factor 29 (.1) Lus10029863 [exp] 53 / 2e-08 AT4G16141 90 / 1e-22 GATA type zinc finger transcription factor family protein (.1) Lus10031464 [exp] 52 / 2e-08 AT3G24050 69 / 3e-15 GATA transcription factor 1 (.1) Lus10009227 [exp] 54 / 3e-08 AT3G54810 162 / 8e-47 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Lus10037994 [exp] 54 / 3e-08 AT3G54810 160 / 6e-46 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Lus10041313 [exp] 53 / 3e-08 AT1G08010 163 / 2e-48 GATA transcription factor 11 (.1.2) Lus10037398 [exp] 53 / 3e-08 AT1G08010 169 / 1e-50 GATA transcription factor 11 (.1.2) Lus10020684 [exp] 52 / 3e-08 AT4G16141 94 / 9e-24 GATA type zinc finger transcription factor family protein (.1) Lus10031096 [exp] 51 / 3e-08 AT5G66320 137 / 1e-40 GATA transcription factor 5 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G161500 [exp] 55 / 6e-09 AT5G66320 178 / 2e-53 GATA transcription factor 5 (.1.2) Potri.014G124400 [exp] 53 / 7e-09 AT5G49300 106 / 2e-30 GATA transcription factor 16 (.1) Potri.006G229200 [exp] 54 / 1e-08 AT4G26150 111 / 3e-28 GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) Potri.010G223300 [exp] 54 / 1e-08 AT3G54810 148 / 8e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Potri.008G038900 [exp] 54 / 1e-08 AT3G54810 150 / 1e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Potri.018G053600 [exp] 54 / 1e-08 AT4G26150 75 / 4e-15 GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) Potri.008G213900 [exp] 51 / 3e-08 AT3G06740 126 / 4e-38 GATA transcription factor 15 (.1) Potri.009G123400 [exp] 53 / 4e-08 AT5G66320 179 / 8e-54 GATA transcription factor 5 (.1.2) Potri.003G213300 [exp] 52 / 5e-08 AT3G20750 64 / 2e-12 GATA transcription factor 29 (.1) Potri.010G001300 [exp] 50 / 7e-08 AT3G06740 135 / 2e-41 GATA transcription factor 15 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF00320 [flax] [poplar] GATA GATA zinc finger
Representative CDS sequence Show only first row Show all	>Lus10042504 pacid=23153980 polypeptide=Lus10042504 locus=Lus10042504.g ID=Lus10042504.BGIv1.0 annot-version=v1.0 ATGATGAAGAAGTTGGATCTCAATCTGAAACTAAGTTTGTCCACTCATGCATCTGAATCTATTGATATTCCAGATGATACTCCTAACAATTTCGATTCCA AGTCTCCATTTACTTTTGATTTTGGCTCCCCTAAAGCCAACATCCCTCAGGATGTGGAGACCGATCTGAGAATCGGTTCAGGTAGTGGAGGAGTGAATCA GCAATATGGGTATGCAGCTCCAGCATCTGGTGGTACTACTGTGGTCGGAGTTCCGGCGGTGGCTGTTTACATGAATCAAATGGAGTTGGTGAATAACAAT GAACCAATACTCCAACTGGCTCCTCCTGGTGATGATCTTAATGAGGGGGGAGAGAGCAGCGACTCTAACTCTAATTCCGCACCAGCTGCTGCTCCTGCTG CTCTTCCTGTTCCTCCTGCTGCTCCTGCTGCTCTTCCTGTTCCTCCTGCTGCTCTTCCTGCTAACTTCTTCAACGGCATGATGACCCGCCAGATTCAGAA TGTCTGCATGCTCTGCAACGTCTCTGAAACTCCTATGTGGCGTCGTGGACCTCATGGCCCAAAGACATTGTGCAACGCGTGTGGAATTAAGTACCATAAG GAGGCGAAGAAGAAGAAGGAAAGGGAAGGTGGTTCAACAAGCGGAAGCAAGTAG
AA sequence Show only first row Show all	>Lus10042504 pacid=23153980 polypeptide=Lus10042504 locus=Lus10042504.g ID=Lus10042504.BGIv1.0 annot-version=v1.0 MMKKLDLNLKLSLSTHASESIDIPDDTPNNFDSKSPFTFDFGSPKANIPQDVETDLRIGSGSGGVNQQYGYAAPASGGTTVVGVPAVAVYMNQMELVNNN EPILQLAPPGDDLNEGGESSDSNSNSAPAAAPAALPVPPAAPAALPVPPAALPANFFNGMMTRQIQNVCMLCNVSETPMWRRGPHGPKTLCNACGIKYHK EAKKKKEREGGSTSGSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G20750	GATA	GATA29	GATA transcription factor 29 (...		Lus10042504 [exp]	0	1
AT2G29380		HAI3	highly ABA-induced PP2C gene 3...		Lus10003887 [exp]	1.4	0.8843
AT1G28360	AP2_ERF	AtERF12	ERF domain protein 12 (.1)		Lus10013993 [exp]	5.5	0.8023
AT1G61800		ATGPT2, GPT2	ARABIDOPSIS GLUCOSE-6-PHOSPHAT...		Lus10018356 [exp]	7.0	0.7751
AT1G61800		ATGPT2, GPT2	ARABIDOPSIS GLUCOSE-6-PHOSPHAT...		Lus10007653 [exp]	13.2	0.8117
AT1G53708		RTFL9	ROTUNDIFOLIA like 9 (.1)		Lus10041259 [exp]	14.3	0.6960
AT3G19940			Major facilitator superfamily ...		Lus10028729 [exp]	17.7	0.7648
AT2G38600			HAD superfamily, subfamily III...		Lus10017060 [exp]	19.0	0.8006
AT3G25280			Major facilitator superfamily ...		Lus10025881 [exp]	23.6	0.7167
AT5G06760		AtLEA4-5, LEA4-...	Late Embryogenesis Abundant 4-...		Lus10004182 [exp]	27.2	0.7102
AT4G39510		CYP96A12	"cytochrome P450, family 96, s...		Lus10018159 [exp]	28.2	0.6844

Compare expression of checked genes

Lus10042504 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.