Lus10042509 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13710 334 / 9e-115 Pectin lyase-like superfamily protein (.1.2)
AT3G24670 327 / 5e-112 Pectin lyase-like superfamily protein (.1)
AT4G13210 322 / 1e-110 Pectin lyase-like superfamily protein (.1.2)
AT3G07010 319 / 4e-109 Pectin lyase-like superfamily protein (.1)
AT1G04680 318 / 1e-108 Pectin lyase-like superfamily protein (.1)
AT4G24780 311 / 4e-106 Pectin lyase-like superfamily protein (.1.2)
AT5G48900 310 / 9e-106 Pectin lyase-like superfamily protein (.1)
AT3G24230 306 / 6e-104 Pectate lyase family protein (.1)
AT1G67750 303 / 6e-103 Pectate lyase family protein (.1)
AT3G27400 303 / 8e-103 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038157 388 / 7e-136 AT4G13710 685 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Lus10011885 360 / 3e-125 AT3G07010 674 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10022817 358 / 3e-124 AT3G24670 673 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10011758 332 / 2e-114 AT4G13710 703 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Lus10023679 333 / 5e-114 AT4G13710 729 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Lus10006456 308 / 7e-105 AT1G67750 625 / 0.0 Pectate lyase family protein (.1)
Lus10011400 307 / 1e-104 AT1G67750 623 / 0.0 Pectate lyase family protein (.1)
Lus10013667 297 / 1e-102 AT5G63180 469 / 4e-167 Pectin lyase-like superfamily protein (.1)
Lus10013668 292 / 1e-100 AT5G63180 424 / 2e-149 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G178100 348 / 2e-120 AT3G07010 652 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.002G238800 342 / 4e-118 AT3G07010 655 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.001G052300 337 / 5e-116 AT4G13710 696 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Potri.003G175900 335 / 4e-115 AT4G13710 681 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Potri.001G339500 306 / 2e-104 AT4G24780 617 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Potri.015G087800 301 / 4e-102 AT5G63180 657 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.012G091500 299 / 1e-101 AT4G24780 645 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Potri.008G182200 299 / 1e-101 AT1G67750 671 / 0.0 Pectate lyase family protein (.1)
Potri.010G051800 298 / 1e-100 AT1G67750 645 / 0.0 Pectate lyase family protein (.1)
Potri.006G122000 267 / 4e-88 AT3G53190 647 / 0.0 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00544 Pectate_lyase_4 Pectate lyase
Representative CDS sequence
>Lus10042509 pacid=23153639 polypeptide=Lus10042509 locus=Lus10042509.g ID=Lus10042509.BGIv1.0 annot-version=v1.0
ATGGCTGATGGAGATGGGGTTTCCATTTTCGACTCGAGCCATATTTGGGTAGACCACAACTCTCTGTCTAACTGCGCCGATGGTCTCATTGATGCCATTA
TGGGATCTACTGCTATTACCATTTCCAACAACTTCTTTACCCACCATAATGAGGTTATTCTATTGGGACATAGTGACTCGTACGTGAGGGACAAGCAAAT
GCAGGTGACTATTGCGTACAATCACTTTGGTGAAGGACTTATCCAGAGGATGCCAAGGTGTCGGCACGGATACTTCCATGTGGTGAACAACGACTACACA
CACTGGGAAATGTATGCAATAGGAGGAAGTGCGAATCCAACCATTAACAGCCAAGGCAATAGATTCCTTGCCCCGAACAACCCTTTTGCCAAGGAGGTGA
CGAAGAGAGTGGAAACGAACAATGGAGTGTGGAAGAGTTGGAACTGGAGGTCAGAAGGGGATCTGCTACTGAATGGGGCTTACTTCAAACCATCAGGAGC
AGGAGCAGGAGCCAGCTACGCTAGGGCTTCAAGCTTAGGAGCGAAACCCTCTTCTTTGGTTGGGATGATCACTTCCACTTCTGGTGCCTTGGTCTGCCGC
AGGGGCCGCTCCTGTTGA
AA sequence
>Lus10042509 pacid=23153639 polypeptide=Lus10042509 locus=Lus10042509.g ID=Lus10042509.BGIv1.0 annot-version=v1.0
MADGDGVSIFDSSHIWVDHNSLSNCADGLIDAIMGSTAITISNNFFTHHNEVILLGHSDSYVRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYT
HWEMYAIGGSANPTINSQGNRFLAPNNPFAKEVTKRVETNNGVWKSWNWRSEGDLLLNGAYFKPSGAGAGASYARASSLGAKPSSLVGMITSTSGALVCR
RGRSC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G13710 Pectin lyase-like superfamily ... Lus10042509 0 1
AT5G14230 unknown protein Lus10041588 2.4 0.7696
AT1G18650 PDCB3 plasmodesmata callose-binding ... Lus10036914 5.2 0.8071
AT3G54400 Eukaryotic aspartyl protease f... Lus10039503 6.2 0.7741
AT5G14230 unknown protein Lus10022339 6.6 0.7641
AT1G66680 AR401 S-adenosyl-L-methionine-depend... Lus10033577 16.0 0.7125
Lus10042511 17.7 0.7377
AT4G32330 TPX2 (targeting protein for Xk... Lus10002915 27.9 0.7583
AT5G39760 ZF_HD ATHB23, ZHD10 ZINC FINGER HOMEODOMAIN 10, ho... Lus10005244 30.3 0.7308
AT2G01630 O-Glycosyl hydrolases family 1... Lus10034607 34.0 0.7316
AT5G02190 EMB24, ATASP38,... PROMOTION OF CELL SURVIVAL 1, ... Lus10024375 35.7 0.7221

Lus10042509 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.