Lus10042510 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07010 81 / 2e-18 Pectin lyase-like superfamily protein (.1)
AT1G04680 76 / 1e-16 Pectin lyase-like superfamily protein (.1)
AT3G24230 75 / 3e-16 Pectate lyase family protein (.1)
AT4G24780 74 / 8e-16 Pectin lyase-like superfamily protein (.1.2)
AT3G53190 66 / 4e-13 Pectin lyase-like superfamily protein (.1)
AT3G24670 63 / 5e-12 Pectin lyase-like superfamily protein (.1)
AT5G63180 57 / 4e-10 Pectin lyase-like superfamily protein (.1)
AT1G67750 56 / 1e-09 Pectate lyase family protein (.1)
AT3G27400 56 / 1e-09 Pectin lyase-like superfamily protein (.1)
AT4G22080 56 / 1e-09 RHS14 root hair specific 14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011885 104 / 1e-26 AT3G07010 674 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10022817 102 / 4e-26 AT3G24670 673 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10011758 94 / 7e-23 AT4G13710 703 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Lus10023679 90 / 2e-21 AT4G13710 729 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Lus10011258 72 / 6e-15 AT1G11920 549 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10036946 71 / 8e-15 AT5G63180 627 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10018429 68 / 1e-13 AT1G11920 437 / 8e-152 Pectin lyase-like superfamily protein (.1)
Lus10005254 62 / 1e-11 AT3G01270 558 / 0.0 Pectate lyase family protein (.1)
Lus10018430 61 / 3e-11 AT1G11920 525 / 0.0 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G238800 100 / 2e-25 AT3G07010 655 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.014G178100 100 / 3e-25 AT3G07010 652 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.003G175900 80 / 5e-18 AT4G13710 681 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Potri.001G052300 79 / 1e-17 AT4G13710 696 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Potri.008G182200 66 / 7e-13 AT1G67750 671 / 0.0 Pectate lyase family protein (.1)
Potri.012G091500 64 / 2e-12 AT4G24780 645 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Potri.015G087800 64 / 2e-12 AT5G63180 657 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.010G051800 57 / 3e-10 AT1G67750 645 / 0.0 Pectate lyase family protein (.1)
Potri.001G339500 54 / 8e-09 AT4G24780 617 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Potri.011G008100 50 / 8e-08 AT4G22080 504 / 2e-179 root hair specific 14 (.1)
PFAM info
Representative CDS sequence
>Lus10042510 pacid=23153816 polypeptide=Lus10042510 locus=Lus10042510.g ID=Lus10042510.BGIv1.0 annot-version=v1.0
ATGCCCCGGAGAGCTCCGCACCATGGCGTTCCCAGTAGGCTTGCAATCGTGGATGTTGAGCCCGTGTATTATAATGTTCGTCACGAATTGGATTGTGATG
CATCCCCCATTGGCAATGTGTACATTGGCTCCCCTGCCGTCTATGGTCTTGAAGCTGTTCATGATCAGCTCTTGTTTCAACGTGATCACCATGTCCCTTT
TGAACACTATCCACAACGGCATGTCCTGTATCACCGCGTGTCGGAGCGTCCCAGGTCTCGGGTTGACTGCATCGTCGTCGCGGGGATCCGTGACCACGTA
GTACCTCCCGTCGCGGCCGCCGACTGCGTTGCGGCGGCCCGCCGCCTGCGTTCGGGCCGAAGCCGATGGCGCAGTCGGCTAACCGTTTTCGGTGAGTTTG
CCAGTGTGGGTCGCACCGCCAGCAGTCGTCGATTGGGTTGCCCGTTGAGCATGAGAAGAATCCTAGTTTCCTTCTTGCAGTGCTATTCATAA
AA sequence
>Lus10042510 pacid=23153816 polypeptide=Lus10042510 locus=Lus10042510.g ID=Lus10042510.BGIv1.0 annot-version=v1.0
MPRRAPHHGVPSRLAIVDVEPVYYNVRHELDCDASPIGNVYIGSPAVYGLEAVHDQLLFQRDHHVPFEHYPQRHVLYHRVSERPRSRVDCIVVAGIRDHV
VPPVAAADCVAAARRLRSGRSRWRSRLTVFGEFASVGRTASSRRLGCPLSMRRILVSFLQCYS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10042510 0 1
AT2G35470 unknown protein Lus10035375 2.0 0.7941
AT3G53900 UPP, PYRR PYRIMIDINE R, uracil phosphori... Lus10012654 7.5 0.7818
AT5G49665 Zinc finger (C3HC4-type RING f... Lus10028225 13.0 0.8106
AT4G20990 ATACA4, ACA4 A. THALIANA ALPHA CARBONIC ANH... Lus10018017 18.2 0.7974
AT3G23710 AtTic22-III translocon at the inner envelo... Lus10007784 43.6 0.7030
AT4G00380 FDM2 factor of DNA methylation 2, X... Lus10005463 46.5 0.7775
AT1G73120 unknown protein Lus10022961 49.5 0.7782
AT3G52270 Transcription initiation facto... Lus10023502 59.0 0.7619
AT3G03920 H/ACA ribonucleoprotein comple... Lus10020289 59.4 0.7764
AT5G66580 unknown protein Lus10000739 69.3 0.7105

Lus10042510 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.