Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038157 [exp] 89 / 4e-22 AT4G13710 685 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042511 pacid=23153989 polypeptide=Lus10042511 locus=Lus10042511.g ID=Lus10042511.BGIv1.0 annot-version=v1.0 ATGGTGGATTCGTCATCTCGTTGGATTCCAGTAGCTGCATTGGTAGTTTTGCTTCTGTTAGTTGCAGCAGCAGCCACAGCCGAGGATCTGAATTATTCGA GGAAGGAGAAATCAATGGAGCTGATGCTGCAGAGATTGGAGAAGAAGAATTCTTCAGTTTCCAGTAACAGGTTGGTTGTGGATCTTGGTGTAGTAGGTGC TGAAAGGAAAATCGCGATGGAGGAGGGTGAGATGGGAAATGAGCATGCAGTGGAGAACCCGGAGGAGATTGCTGAAATGGTGAATGAGTGA
AA sequence Show only first row Show all	>Lus10042511 pacid=23153989 polypeptide=Lus10042511 locus=Lus10042511.g ID=Lus10042511.BGIv1.0 annot-version=v1.0 MVDSSSRWIPVAALVVLLLLVAAAATAEDLNYSRKEKSMELMLQRLEKKNSSVSSNRLVVDLGVVGAERKIAMEEGEMGNEHAVENPEEIAEMVNE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10042511 [exp]	0	1
AT5G02190		EMB24, ATASP38,...	PROMOTION OF CELL SURVIVAL 1, ...		Lus10024375 [exp]	1.0	0.9030
AT2G15480		UGT73B5	UDP-glucosyl transferase 73B5 ...		Lus10026927 [exp]	2.4	0.8737
AT5G63810		BGAL10	beta-galactosidase 10 (.1)		Lus10022645 [exp]	3.2	0.8981
AT4G20160			unknown protein		Lus10036249 [exp]	7.2	0.8674
AT4G04940			transducin family protein / WD...		Lus10036625 [exp]	7.4	0.8402
AT5G45380		ATDUR3	DEGRADATION OF UREA 3, solute:...		Lus10000112 [exp]	10.2	0.7699
AT4G28780			GDSL-like Lipase/Acylhydrolase...		Lus10004770 [exp]	12.7	0.8399
AT4G13710			Pectin lyase-like superfamily ...		Lus10042509 [exp]	17.7	0.7377
AT5G45950			GDSL-like Lipase/Acylhydrolase...		Lus10013956 [exp]	18.1	0.8316
AT5G14230			unknown protein		Lus10041588 [exp]	18.2	0.7168

Compare expression of checked genes

Lus10042511 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.