Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18370 64 / 2e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G33355 61 / 2e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G59310 58 / 2e-12 LTP4 lipid transfer protein 4 (.1) AT2G38540 55 / 6e-11 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT5G59320 53 / 2e-10 LTP3 lipid transfer protein 3 (.1) AT2G38530 52 / 5e-10 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT2G15050 52 / 9e-10 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT3G51590 51 / 2e-09 LTP12 lipid transfer protein 12 (.1) AT3G08770 50 / 2e-09 LTP6 lipid transfer protein 6 (.1.2) AT3G51600 48 / 2e-08 LTP5 lipid transfer protein 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039270 [exp] 170 / 1e-56 AT5G59310 69 / 4e-16 lipid transfer protein 4 (.1) Lus10031282 [exp] 167 / 1e-55 AT4G33355 56 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10031851 [exp] 167 / 7e-54 AT5G58510 109 / 2e-27 unknown protein Lus10032716 [exp] 92 / 2e-26 AT4G33355 42 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10009630 [exp] 88 / 1e-23 AT3G51590 59 / 5e-12 lipid transfer protein 12 (.1) Lus10009003 [exp] 82 / 1e-21 AT3G51590 59 / 5e-12 lipid transfer protein 12 (.1) Lus10026418 [exp] 69 / 3e-16 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10001703 [exp] 64 / 1e-14 AT4G33355 86 / 9e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10025234 [exp] 62 / 5e-14 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G232700 [exp] 67 / 6e-16 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 66 / 3e-15 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135700 [exp] 65 / 5e-15 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.016G135500 [exp] 62 / 6e-14 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.006G108100 [exp] 58 / 3e-12 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135400 [exp] 58 / 4e-12 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.009G025200 [exp] 54 / 1e-10 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086600 [exp] 52 / 5e-10 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.011G021900 [exp] 52 / 7e-10 AT3G08770 60 / 8e-13 lipid transfer protein 6 (.1.2) Potri.014G046500 [exp] 50 / 2e-09 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10042512 pacid=23181955 polypeptide=Lus10042512 locus=Lus10042512.g ID=Lus10042512.BGIv1.0 annot-version=v1.0 ATGACTTCCATTAGTTGCAGTACGGTGGATGACGATGCACGACCGTGTTTACCGTACGCTACCGGTAAAAGCAACTCAGTAGCACCAGATTGTTGCTCTG GCCTACAAAATTTAGTTGCGAGTACATCCACTAATGACGATAAGAAGATAGCTTGTAATTGTCTTGTCACTGCTTTCAAGATCTTTCCGGTACAAGATGA CTTGTTGAAAAAGATTCCAGACTTATGCAAACTTAAAGTTCCATTCAATATGTCAACCACAGTTGACTGTGACAAGTAA
AA sequence Show only first row Show all	>Lus10042512 pacid=23181955 polypeptide=Lus10042512 locus=Lus10042512.g ID=Lus10042512.BGIv1.0 annot-version=v1.0 MTSISCSTVDDDARPCLPYATGKSNSVAPDCCSGLQNLVASTSTNDDKKIACNCLVTAFKIFPVQDDLLKKIPDLCKLKVPFNMSTTVDCDK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G18370			Bifunctional inhibitor/lipid-t...		Lus10042512 [exp]	0	1
AT1G08080		ATACA7, ACA7	A. THALIANA ALPHA CARBONIC ANH...		Lus10021456 [exp]	3.0	0.9554
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10037137 [exp]	3.2	0.9030
AT1G03620			ELMO/CED-12 family protein (.1...		Lus10018574 [exp]	4.2	0.8175
AT5G09360		LAC14	laccase 14 (.1)		Lus10036070 [exp]	4.5	0.9491
AT4G02050		STP7	sugar transporter protein 7 (....		Lus10008372 [exp]	5.5	0.9491
AT3G19090			RNA-binding protein (.1)		Lus10027925 [exp]	6.2	0.8717
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10008919 [exp]	6.3	0.9491
AT2G26490			Transducin/WD40 repeat-like su...		Lus10016289 [exp]	7.1	0.9491
AT3G18080		BGLU44	B-S glucosidase 44 (.1)		Lus10017997 [exp]	7.7	0.9491
AT1G55790			Domain of unknown function (DU...		Lus10032900 [exp]	8.4	0.9330

Compare expression of checked genes

Lus10042512 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.