Lus10042517 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G39160 250 / 2e-84 RmlC-like cupins superfamily protein (.1.2.3)
AT5G39190 249 / 3e-84 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2)
AT5G39130 248 / 9e-84 RmlC-like cupins superfamily protein (.1)
AT5G39110 248 / 1e-83 RmlC-like cupins superfamily protein (.1)
AT5G39150 248 / 1e-83 RmlC-like cupins superfamily protein (.1)
AT5G39120 248 / 1e-83 RmlC-like cupins superfamily protein (.1)
AT5G39180 248 / 2e-83 RmlC-like cupins superfamily protein (.1)
AT3G05950 237 / 3e-79 RmlC-like cupins superfamily protein (.1)
AT4G14630 233 / 8e-78 GLP9 germin-like protein 9 (.1)
AT5G38960 233 / 1e-77 RmlC-like cupins superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021980 401 / 6e-144 AT5G39160 249 / 5e-84 RmlC-like cupins superfamily protein (.1.2.3)
Lus10006538 270 / 4e-92 AT5G39120 313 / 3e-109 RmlC-like cupins superfamily protein (.1)
Lus10000622 268 / 2e-91 AT5G39130 307 / 7e-107 RmlC-like cupins superfamily protein (.1)
Lus10006536 262 / 4e-89 AT5G39150 308 / 2e-107 RmlC-like cupins superfamily protein (.1)
Lus10033767 262 / 4e-89 AT5G39150 298 / 2e-103 RmlC-like cupins superfamily protein (.1)
Lus10003116 261 / 1e-88 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10003114 255 / 2e-86 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10006543 255 / 2e-86 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10035278 230 / 2e-76 AT3G05950 254 / 3e-86 RmlC-like cupins superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G026200 263 / 2e-89 AT3G05950 308 / 2e-107 RmlC-like cupins superfamily protein (.1)
Potri.019G026400 262 / 4e-89 AT3G05950 288 / 2e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G026500 262 / 4e-89 AT3G05950 288 / 2e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G026700 261 / 1e-88 AT3G05950 286 / 1e-98 RmlC-like cupins superfamily protein (.1)
Potri.019G025800 260 / 2e-88 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G025900 260 / 2e-88 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G026000 260 / 2e-88 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1)
Potri.013G052000 259 / 8e-88 AT5G39110 282 / 5e-97 RmlC-like cupins superfamily protein (.1)
Potri.013G052100 258 / 1e-87 AT5G39110 285 / 2e-98 RmlC-like cupins superfamily protein (.1)
Potri.013G052300 256 / 2e-86 AT5G39110 281 / 2e-96 RmlC-like cupins superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF00190 Cupin_1 Cupin
Representative CDS sequence
>Lus10042517 pacid=23181663 polypeptide=Lus10042517 locus=Lus10042517.g ID=Lus10042517.BGIv1.0 annot-version=v1.0
ATGAATCGACAAGTTCAACACTACCTTTCCTTCCTTGCCTTGGCTCTATTCCTCTTTGCTCAGCTGTCTCCACTGATCCTCGTCTCAGCTGTCGATTCCG
CTCCTCTCCAGGACTTCTGTGTCGCTGTCAATGACACCCAAAACAGTGTTTTTGCGAACGGGCATGTGTGCAAAGACCCGAAGAAAGTAACGGCAGACGA
TTTCTTCCTGACCGGTCTTGATAAACCCGGTAACACTTCCAACCCGTTTGGGTCCAAGGTCACCCTCATCAACGTTGACCGGATTCCGGGGCTCAATACG
CTGGGGATATCTCTGGCACGGGTTGACTACGTCCCGAACGGCGGGGGGAACCCGCTCCATTACCACCCTCGAGCCACAGAGCTCTTTCTCGCGCTCGAGG
GGAAGTTTTACGTCGGGTTCATCGCTTCGAATCCGGACCGGTTGATTTCCAAAGTGCTGAAGCCTGGAGATTTGTTTGTTTTCCCCATTGGAAGGATCCA
CTTTCAGTACAACATTGGGAAAACTCCAGGCAGGGCTGTTTCTGGGTTGAGCAGCCAGAACCCGGGTATCGTTGTGATCGCCAACGCCGTTTTCGGGTCA
AACCCAAGCATTGATCCGAGTTTGCTCGCCGCTGCCTTTCGGGCGGACAAGGAGTTGGTGGAGGACTTGCAGAAGAAATTCTAG
AA sequence
>Lus10042517 pacid=23181663 polypeptide=Lus10042517 locus=Lus10042517.g ID=Lus10042517.BGIv1.0 annot-version=v1.0
MNRQVQHYLSFLALALFLFAQLSPLILVSAVDSAPLQDFCVAVNDTQNSVFANGHVCKDPKKVTADDFFLTGLDKPGNTSNPFGSKVTLINVDRIPGLNT
LGISLARVDYVPNGGGNPLHYHPRATELFLALEGKFYVGFIASNPDRLISKVLKPGDLFVFPIGRIHFQYNIGKTPGRAVSGLSSQNPGIVVIANAVFGS
NPSIDPSLLAAAFRADKELVEDLQKKF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G39160 RmlC-like cupins superfamily p... Lus10042517 0 1
AT5G06740 Concanavalin A-like lectin pro... Lus10016257 8.6 0.9068
AT1G65820 microsomal glutathione s-trans... Lus10007375 12.0 0.9129
AT3G26300 CYP71B34 "cytochrome P450, family 71, s... Lus10017676 12.1 0.8229
AT5G01650 Tautomerase/MIF superfamily pr... Lus10012223 18.8 0.8874
AT4G01870 tolB protein-related (.1) Lus10038052 25.5 0.8978
AT3G13600 calmodulin-binding family prot... Lus10039178 25.6 0.8817
AT5G53110 RING/U-box superfamily protein... Lus10012628 28.6 0.8564
AT5G39150 RmlC-like cupins superfamily p... Lus10033767 30.3 0.8940
AT3G26300 CYP71B34 "cytochrome P450, family 71, s... Lus10041667 31.5 0.8381
AT1G07250 UGT71C4 UDP-glucosyl transferase 71C4 ... Lus10003805 32.3 0.8845

Lus10042517 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.