Lus10042530 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G15010 182 / 3e-55 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G80880 111 / 3e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G65560 89 / 3e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G22470 83 / 3e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63150 83 / 4e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G53700 82 / 7e-19 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G06920 82 / 8e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G63330 81 / 1e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G02420 81 / 1e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G65820 81 / 2e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021991 266 / 6e-87 AT5G15010 617 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10041669 109 / 2e-28 AT1G80880 511 / 2e-177 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040633 87 / 2e-20 AT3G61520 586 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10014247 87 / 2e-20 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10003446 83 / 3e-20 AT1G62930 137 / 2e-37 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10018567 86 / 4e-20 AT1G03560 862 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10003433 86 / 5e-20 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10039799 84 / 1e-19 AT1G03560 473 / 5e-164 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10025533 84 / 1e-19 AT1G06710 980 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G053600 193 / 3e-59 AT5G15010 659 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G043500 113 / 6e-30 AT1G80880 570 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G032600 89 / 2e-21 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G034400 87 / 9e-21 AT3G22470 476 / 1e-161 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G008900 85 / 6e-20 AT2G32630 612 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.010G014100 85 / 6e-20 AT3G06920 1404 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.015G105400 85 / 8e-20 AT5G61990 773 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G034200 85 / 9e-20 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G124900 84 / 2e-19 AT5G65560 909 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.009G105600 84 / 2e-19 AT5G39710 1022 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10042530 pacid=23181682 polypeptide=Lus10042530 locus=Lus10042530.g ID=Lus10042530.BGIv1.0 annot-version=v1.0
ATGTCCAAAAGAGGAATCCTTTACGATGTTGTTTCATACTCGAGTATCTTATCTTGTTATTCAAAGGCGGGGAACATTTACAAGGTTCTGAAAATGTACG
ATAGGATGAAAGAAATGAACATCGAACCAGATAGGAAAGTGCATAATGCTGTTATTCAGGCTCTTGCAAAGGTCAGGCATGCAAAGGAAGCTATTGATCT
CATGAAGACAATGGATGAGAAGGGTGTTTCGCTCAATGCTGTGACGTATAATTCATTGATTAAGCCCTTGTGCAAGGCACAAAAAATAGACGAAGCGAGA
ATTGTCTTTGATGAGATGTTTCAACATGGGCTTCCTCCAACAGTACAGACATATCATGCTTTCTTGCGCTACCTCCGGACCGCTGAGGGAGCATTTGAAA
AATTGGAAAACATGACAAAGGTAGGATACCTACTAACGAGACCTACATGA
AA sequence
>Lus10042530 pacid=23181682 polypeptide=Lus10042530 locus=Lus10042530.g ID=Lus10042530.BGIv1.0 annot-version=v1.0
MSKRGILYDVVSYSSILSCYSKAGNIYKVLKMYDRMKEMNIEPDRKVHNAVIQALAKVRHAKEAIDLMKTMDEKGVSLNAVTYNSLIKPLCKAQKIDEAR
IVFDEMFQHGLPPTVQTYHAFLRYLRTAEGAFEKLENMTKVGYLLTRPT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G15010 Tetratricopeptide repeat (TPR)... Lus10042530 0 1
AT2G26210 Ankyrin repeat family protein ... Lus10034882 8.3 0.7501
Lus10022574 11.4 0.6991
AT2G45880 BZR BAM7, BMY4 BETA-AMYLASE 4, beta-amylase 7... Lus10017820 23.7 0.7035
AT5G65560 Pentatricopeptide repeat (PPR)... Lus10042529 47.1 0.6428
AT1G68310 AE7 AS1/2 ENHANCER7, Protein of un... Lus10035404 64.1 0.6771
AT5G18070 DRT101 DNA-DAMAGE-REPAIR/TOLERATION 1... Lus10007545 76.0 0.6103
AT5G28740 Tetratricopeptide repeat (TPR)... Lus10003865 113.4 0.6416
Lus10015577 144.9 0.5963
Lus10019733 150.3 0.6173
AT1G79750 ATNADP-ME4 Arabidopsis thaliana NADP-mali... Lus10034963 171.2 0.6143

Lus10042530 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.