Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G08780 186 / 5e-62 PFD4, PDF4, AIP3, ABI3, API3 PREFOLDIN 4, ABI3-interacting protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021994 [exp] 243 / 9e-85 AT1G08780 187 / 2e-62 PREFOLDIN 4, ABI3-interacting protein 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G054500 [exp] 213 / 6e-73 AT1G08780 183 / 7e-61 PREFOLDIN 4, ABI3-interacting protein 3 (.1) Potri.013G042100 [exp] 206 / 6e-70 AT1G08780 187 / 9e-63 PREFOLDIN 4, ABI3-interacting protein 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0200 [flax] [poplar] Prefoldin PF01920 [flax] [poplar] Prefoldin_2 Prefoldin subunit
Representative CDS sequence Show only first row Show all	>Lus10042533 pacid=23182052 polypeptide=Lus10042533 locus=Lus10042533.g ID=Lus10042533.BGIv1.0 annot-version=v1.0 ATGCAACAGAGCGGCGGATCCGAGACACAGGTAACTTGGGAGGATCAGCAGAACATCAACAAATTCGGAAGGCTCAACAACCGATTTCACGAGCTCGAGG AAGAGATCAAGACTGCCAAGGAAACGAATGAGAATCTGGAGGATGCGGGCAACGAGCTGATTCTTACAGACGAGGATGTTGTGCGATTCCAGATAGGAGA GGTATTTGCACATGTTGACAAGGATGAAGTTGAGACCCGGATAGAGGCGATGAAAGAGACGACTTCCAGGAACTTGGAGAAACTGGAAGAGGAGAAAGTT TCAATCTTGGCACAGATGGGGGAGTTGAAGAAGATTCTGTATGGAAAGTTTGGAGATTCCATTAACCTTGAAGAGGACTAA
AA sequence Show only first row Show all	>Lus10042533 pacid=23182052 polypeptide=Lus10042533 locus=Lus10042533.g ID=Lus10042533.BGIv1.0 annot-version=v1.0 MQQSGGSETQVTWEDQQNINKFGRLNNRFHELEEEIKTAKETNENLEDAGNELILTDEDVVRFQIGEVFAHVDKDEVETRIEAMKETTSRNLEKLEEEKV SILAQMGELKKILYGKFGDSINLEED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G08780		PFD4, PDF4, AIP...	PREFOLDIN 4, ABI3-interacting ...		Lus10042533 [exp]	0	1
AT1G03590			Protein phosphatase 2C family ...		Lus10031631 [exp]	1.0	0.9027
AT5G54850			unknown protein		Lus10043054 [exp]	2.4	0.8832
AT5G17620			unknown protein		Lus10001340 [exp]	4.6	0.8551
AT5G17620			unknown protein		Lus10013643 [exp]	7.3	0.8553
AT1G13330		AHP2	Arabidopsis Hop2 homolog (.1)		Lus10035033 [exp]	7.5	0.8085
AT1G08780		PFD4, PDF4, AIP...	PREFOLDIN 4, ABI3-interacting ...		Lus10021994 [exp]	7.7	0.8394
AT1G68910		WIT2	WPP domain-interacting protein...		Lus10013053 [exp]	8.1	0.8652
AT3G11210			SGNH hydrolase-type esterase s...		Lus10027793 [exp]	9.3	0.7985
AT4G26540			Leucine-rich repeat receptor-l...		Lus10005848 [exp]	10.1	0.8024
AT1G34770			unknown protein		Lus10033452 [exp]	11.6	0.8101

Compare expression of checked genes

Lus10042533 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.