Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14045 130 / 2e-40 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022007 [exp] 165 / 7e-52 AT2G14045 126 / 3e-36 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G014100 [exp] 124 / 6e-38 AT2G14045 142 / 5e-45 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042548 pacid=23181802 polypeptide=Lus10042548 locus=Lus10042548.g ID=Lus10042548.BGIv1.0 annot-version=v1.0 ATGCAGGAAAAGGAAGCGAAGAAGGAAGCTTTCAGAAAGTACCTTGAATCCAGTGGAGTTGTTGATACCGTCACTAAAGCTCTAGTCGCATTGTACGAGC AAGATGAGAAGCCTTCATCAGCTCTCGAATTCATTCAACAGAAGTTGGGCGGTCCAAGTGTGTGTGACTACGAGAAGTTACAAGCCGAGATGTCGGATTT GCAACTCAAGTACAATGAGCTTTTGTTAACTCATCAACAAGTTGTCAAAGAGTTGGAAGGACTCGAGAACTCGAATGACATTGCAGCCACTGCTGCTGCT GCTAATACTACCGCCATTGCTGAAGTGGTGAATGGGGATGTTCTGAAGGATGATGACTGA
AA sequence Show only first row Show all	>Lus10042548 pacid=23181802 polypeptide=Lus10042548 locus=Lus10042548.g ID=Lus10042548.BGIv1.0 annot-version=v1.0 MQEKEAKKEAFRKYLESSGVVDTVTKALVALYEQDEKPSSALEFIQQKLGGPSVCDYEKLQAEMSDLQLKYNELLLTHQQVVKELEGLENSNDIAATAAA ANTTAIAEVVNGDVLKDDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14045			unknown protein		Lus10042548 [exp]	0	1
AT5G64813		LIP1	Light Insensitive Period1, Ras...		Lus10006805 [exp]	1.0	0.8500
AT5G65260			RNA-binding (RRM/RBD/RNP motif...		Lus10015840 [exp]	1.4	0.8370
AT5G47870		RAD52-2B, RAD52...	radiation sensitive 51-2, unkn...		Lus10000280 [exp]	1.7	0.7986
AT3G08510		ATPLC2	phospholipase C 2 (.1.2.3)		Lus10014845 [exp]	3.9	0.7346
AT1G53035			unknown protein		Lus10018600 [exp]	4.9	0.7672
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Lus10022927 [exp]	16.1	0.6887
AT1G22100			Inositol-pentakisphosphate 2-k...		Lus10024274 [exp]	16.1	0.6943
AT3G60340			alpha/beta-Hydrolases superfam...		Lus10042902 [exp]	17.0	0.7168
AT2G35760			Uncharacterised protein family...		Lus10039060 [exp]	19.4	0.7222
AT1G63800		UBC5	ubiquitin-conjugating enzyme 5...		Lus10042136 [exp]	19.6	0.6900

Compare expression of checked genes

Lus10042548 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.