Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18980 94 / 4e-24 ARM repeat superfamily protein (.1) AT3G06210 93 / 1e-23 ARM repeat superfamily protein (.1) AT4G14280 79 / 9e-19 ARM repeat superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034018 [exp] 134 / 3e-38 AT5G18980 1065 / 0.0 ARM repeat superfamily protein (.1) Lus10001111 [exp] 132 / 2e-37 AT5G18980 1036 / 0.0 ARM repeat superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G029300 [exp] 112 / 2e-30 AT5G18980 1039 / 0.0 ARM repeat superfamily protein (.1) Potri.008G200500 [exp] 104 / 8e-28 AT5G18980 1009 / 0.0 ARM repeat superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042594 pacid=23182054 polypeptide=Lus10042594 locus=Lus10042594.g ID=Lus10042594.BGIv1.0 annot-version=v1.0 ATGTTGAATTGGAAAGATTTACTAGAGGAGGAGGCACTGAGGTCAGCAGCCGAAATCCTGTCGAATCTAGCGGGAAAGAAGCAGAATTCATTGAGGGTTG CTGGGATACCGGGAGCAATGGAATCAATCTCTTCATTGCTTCAGACCAATAGGGCTTCGAGCAGTTCCGCTGACGAGGTTGGGGAAAAGAAGATCATATT CGACTGTCTGAATTATGGGTTTTGGACGTTTAACCATTTGGGACTTGAATGA
AA sequence Show only first row Show all	>Lus10042594 pacid=23182054 polypeptide=Lus10042594 locus=Lus10042594.g ID=Lus10042594.BGIv1.0 annot-version=v1.0 MLNWKDLLEEEALRSAAEILSNLAGKKQNSLRVAGIPGAMESISSLLQTNRASSSSADEVGEKKIIFDCLNYGFWTFNHLGLE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18980			ARM repeat superfamily protein...		Lus10042594 [exp]	0	1
AT4G39980		DHS1	3-deoxy-D-arabino-heptulosonat...		Lus10023152 [exp]	13.4	0.9113
AT5G15630		IRX6, COBL4	IRREGULAR XYLEM 6, COBRA-LIKE4...		Lus10017863 [exp]	22.4	0.8960
AT3G27960			Tetratricopeptide repeat (TPR)...		Lus10022231 [exp]	24.1	0.8899
AT5G55950			Nucleotide/sugar transporter f...		Lus10022563 [exp]	27.3	0.8887
AT1G19630		CYP722A1	"cytochrome P450, family 722, ...		Lus10024272 [exp]	30.2	0.8880
AT1G30900		VSR6, VSR3;3, B...	VACUOLAR SORTING RECEPTOR 3;3,...		Lus10006944 [exp]	35.2	0.8877
AT5G22400			Rho GTPase activating protein ...		Lus10022700 [exp]	45.1	0.8797
AT1G13635			DNA glycosylase superfamily pr...		Lus10036835 [exp]	48.3	0.8802
AT2G38320		TBL34	TRICHOME BIREFRINGENCE-LIKE 34...		Lus10014238 [exp]	48.5	0.8813
AT1G13635			DNA glycosylase superfamily pr...		Lus10019198 [exp]	56.5	0.8769

Compare expression of checked genes

Lus10042594 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.