Lus10042595 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G03150 348 / 6e-125 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
AT5G13780 102 / 8e-28 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
AT2G38130 45 / 4e-06 ATMAK3 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
AT5G16800 41 / 0.0002 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022048 347 / 3e-124 AT1G03150 333 / 6e-119 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10016378 97 / 1e-25 AT5G13780 292 / 5e-102 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10041514 42 / 8e-05 AT2G38130 287 / 3e-100 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Lus10019745 39 / 0.0003 AT5G13780 112 / 6e-33 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10012579 40 / 0.0004 AT2G38130 286 / 7e-100 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G210400 348 / 1e-124 AT1G03150 350 / 2e-125 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.002G052000 286 / 7e-101 AT1G03150 287 / 4e-101 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.009G056600 103 / 5e-28 AT5G13780 307 / 5e-108 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.001G261800 99 / 2e-26 AT5G13780 301 / 8e-106 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.006G142100 50 / 1e-07 AT2G06025 347 / 1e-120 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.011G139300 43 / 3e-05 AT2G38130 294 / 1e-102 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.001G435300 40 / 0.0003 AT2G38130 299 / 6e-105 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.001G429200 40 / 0.0003 AT2G38130 299 / 6e-105 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.001G432400 40 / 0.0003 AT2G38130 296 / 4e-104 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0257 Acetyltrans PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Representative CDS sequence
>Lus10042595 pacid=23181934 polypeptide=Lus10042595 locus=Lus10042595.g ID=Lus10042595.BGIv1.0 annot-version=v1.0
ATGACGACGATAAAGCGCTTCTGCTGCAACGACCTTCTCCGATTCGCTTCCGTCAACCTCGACCATCTCACCGAAACCTTCAACATGTCATTTTACATGA
CCTACTTGGCGAGATGGCCTGATTATTTCCACGTCGCCGATGCCCCCGGCAACAAAGTTATGGGATACATTATGGGGAAAGTGGAAGGACAAGGCGAATC
GTGGCATGGTCACGTGACGGCGGTTACGGTGGCTACAGAGTACCGCCGGCAGCAATTGGCCAAGAAGCTTATGAACCTGCTAGAAGATATCAGCGACAAG
ATTGACAAGGGTTACTTCGTGGATCTTTTTGTGAGAGCATCTAATACACCAGCCATCAAGATGTATGAGAAGCTTGGATATATAATTTACAGAAGGGTTC
TCCGGTACTACTCTGGAGAGGAAGATGGCTTAGATATGAGGAAAGCTCTTTCTCGTGACGTGGAGAAGAAATCGATTATCCCTCTTAAGCGACCGATTAC
TCCTGATGAGTTAGAGTACGATTAA
AA sequence
>Lus10042595 pacid=23181934 polypeptide=Lus10042595 locus=Lus10042595.g ID=Lus10042595.BGIv1.0 annot-version=v1.0
MTTIKRFCCNDLLRFASVNLDHLTETFNMSFYMTYLARWPDYFHVADAPGNKVMGYIMGKVEGQGESWHGHVTAVTVATEYRRQQLAKKLMNLLEDISDK
IDKGYFVDLFVRASNTPAIKMYEKLGYIIYRRVLRYYSGEEDGLDMRKALSRDVEKKSIIPLKRPITPDELEYD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G03150 Acyl-CoA N-acyltransferases (N... Lus10042595 0 1
AT1G03150 Acyl-CoA N-acyltransferases (N... Lus10022048 1.0 0.8703
AT5G25080 Sas10/Utp3/C1D family (.1) Lus10026882 3.9 0.8357
AT5G05780 RPN8A, AE3, ATH... ASYMMETRIC LEAVES ENHANCER 3, ... Lus10035522 4.9 0.8118
AT1G36240 Ribosomal protein L7Ae/L30e/S1... Lus10016432 5.5 0.8389
AT1G47740 PPPDE putative thiol peptidase... Lus10032708 6.5 0.8208
AT5G14800 EMB2772, AT-P5C... EMBRYO DEFECTIVE 2772, pyrroli... Lus10019103 9.7 0.7354
AT1G02280 PPI1, ATTOC33, ... PLASTID PROTEIN IMPORT 1, tran... Lus10010292 9.9 0.8072
AT5G02610 Ribosomal L29 family protein ... Lus10025292 10.0 0.8245
AT2G19080 metaxin-related (.1) Lus10015535 10.6 0.7908
AT4G02610 Aldolase-type TIM barrel famil... Lus10024849 11.2 0.7721

Lus10042595 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.