Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27030 72 / 2e-18 CAM5, CAM2, ACAM-2, ACAM-5 calmodulin 5 (.1.2.3) AT5G21274 72 / 4e-18 ACAM-6, CAM6 calmodulin 6 (.1) AT3G56800 72 / 4e-18 ACAM-3, CAM3 calmodulin 3 (.1) AT2G41110 72 / 4e-18 ACAM-2, ATCAL5, CAM2 calmodulin 2 (.1.2) AT3G43810 72 / 4e-18 CAM7 calmodulin 7 (.1) AT1G66410 71 / 2e-17 ACAM-4, CAM4 calmodulin 4 (.1.2) AT5G37780 71 / 2e-17 ACAM-1, TCH1, CAM1 TOUCH 1, calmodulin 1 (.1.2.3) AT3G22930 57 / 9e-12 CML11 calmodulin-like 11 (.1) AT4G14640 56 / 1e-11 CAM8, AtCML8 calmodulin-like 8, calmodulin 8 (.1) AT2G41090 40 / 2e-05 Calcium-binding EF-hand family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006262 [exp] 92 / 2e-26 AT3G56800 79 / 6e-20 calmodulin 3 (.1) Lus10037423 [exp] 72 / 5e-18 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10038981 [exp] 72 / 5e-18 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10027283 [exp] 72 / 5e-18 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10021487 [exp] 72 / 6e-18 AT2G41110 255 / 1e-88 calmodulin 2 (.1.2) Lus10022589 [exp] 72 / 1e-17 AT3G43810 255 / 2e-88 calmodulin 7 (.1) Lus10010386 [exp] 63 / 3e-15 AT2G27030 73 / 7e-19 calmodulin 5 (.1.2.3) Lus10039391 [exp] 62 / 7e-14 AT4G14640 268 / 1e-93 calmodulin-like 8, calmodulin 8 (.1) Lus10035028 [exp] 61 / 2e-13 AT3G24560 171 / 2e-50 RASPBERRY 3, Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G024700 [exp] 72 / 4e-18 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.009G021500 [exp] 72 / 4e-18 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.006G026700 [exp] 72 / 4e-18 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.012G041000 [exp] 71 / 1e-17 AT5G37780 283 / 9e-100 TOUCH 1, calmodulin 1 (.1.2.3) Potri.015G032600 [exp] 71 / 1e-17 AT5G37780 284 / 3e-100 TOUCH 1, calmodulin 1 (.1.2.3) Potri.001G222200 [exp] 69 / 2e-16 AT2G27030 304 / 6e-107 calmodulin 5 (.1.2.3) Potri.010G080900 [exp] 61 / 1e-13 AT4G14640 270 / 2e-94 calmodulin-like 8, calmodulin 8 (.1) Potri.008G159300 [exp] 59 / 9e-13 AT3G22930 235 / 1e-80 calmodulin-like 11 (.1) Potri.005G052800 [exp] 54 / 4e-11 AT4G14640 228 / 7e-78 calmodulin-like 8, calmodulin 8 (.1) Potri.013G040300 [exp] 54 / 9e-11 AT3G22930 210 / 1e-70 calmodulin-like 11 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042597 pacid=23181731 polypeptide=Lus10042597 locus=Lus10042597.g ID=Lus10042597.BGIv1.0 annot-version=v1.0 ATGTTCTTGCTTCATGTTGCATCACCACCAAGGAGTTGGGAACAGTTATGCGTTCACTGGGCCCGTAAGATGAAGGACACCGACTCAGAAGAGGAGCCGA AGGAGGCATTCAGGGCATTCGAGAAGGATCAGAACGGTTTCATATCTACTGCAAAGCTCCGCCACGCGATGACAAATGTTTGA
AA sequence Show only first row Show all	>Lus10042597 pacid=23181731 polypeptide=Lus10042597 locus=Lus10042597.g ID=Lus10042597.BGIv1.0 annot-version=v1.0 MFLLHVASPPRSWEQLCVHWARKMKDTDSEEEPKEAFRAFEKDQNGFISTAKLRHAMTNV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G56800		ACAM-3, CAM3	calmodulin 3 (.1)		Lus10042597 [exp]	0	1
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10025151 [exp]	1.0	0.8553
					Lus10011686 [exp]	15.0	0.8442
AT1G33590			Leucine-rich repeat (LRR) fami...		Lus10006159 [exp]	15.6	0.6885
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10006740 [exp]	17.6	0.8090
AT3G19090			RNA-binding protein (.1)		Lus10012058 [exp]	22.2	0.6541
					Lus10041024 [exp]	26.5	0.8036
AT3G47570			Leucine-rich repeat protein ki...		Lus10035724 [exp]	29.7	0.8002
AT5G06500	MADS	AGL96	AGAMOUS-like 96 (.1)		Lus10012154 [exp]	30.3	0.7925
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Lus10016660 [exp]	31.3	0.7936
AT1G30050			unknown protein		Lus10035609 [exp]	38.2	0.7915

Compare expression of checked genes

Lus10042597 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.