Lus10042603 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G09800 274 / 2e-96 RPS18C S18 ribosomal protein (.1)
AT1G34030 274 / 2e-96 Ribosomal protein S13/S18 family (.1)
AT1G22780 274 / 2e-96 RPS18A, PFL1, PFL 40S RIBOSOMAL PROTEIN S18, POINTED FIRST LEAVES 1, POINTED FIRST LEAVES, Ribosomal protein S13/S18 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006914 283 / 1e-99 AT4G09800 304 / 5e-108 S18 ribosomal protein (.1)
Lus10014676 281 / 4e-99 AT1G34030 303 / 1e-107 Ribosomal protein S13/S18 family (.1)
Lus10022057 281 / 4e-99 AT4G09800 303 / 1e-107 S18 ribosomal protein (.1)
Lus10034179 281 / 7e-99 AT1G34030 302 / 3e-107 Ribosomal protein S13/S18 family (.1)
Lus10043405 224 / 6e-77 AT1G34030 245 / 3e-85 Ribosomal protein S13/S18 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G211200 281 / 4e-99 AT4G09800 276 / 7e-97 S18 ribosomal protein (.1)
Potri.002G051300 280 / 1e-98 AT4G09800 275 / 2e-96 S18 ribosomal protein (.1)
Potri.005G196600 275 / 3e-95 AT4G09800 278 / 2e-96 S18 ribosomal protein (.1)
Potri.002G064632 135 / 3e-42 AT4G09800 151 / 7e-49 S18 ribosomal protein (.1)
Potri.002G088400 47 / 5e-07 AT1G77750 175 / 4e-56 Ribosomal protein S13/S18 family (.1)
Potri.005G172600 39 / 0.0006 AT5G14320 227 / 5e-77 EMBRYO DEFECTIVE 3137, Ribosomal protein S13/S18 family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0303 H2TH PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Representative CDS sequence
>Lus10042603 pacid=23181737 polypeptide=Lus10042603 locus=Lus10042603.g ID=Lus10042603.BGIv1.0 annot-version=v1.0
ATGTCTCTCGTTGCAAATGAGGAGTTTCAGCACATTCTTCGTGTCCTCAACACCAACGTTGATGGAAAGCAGAAGATCATGTTTGCCCTGACCTCTATCA
AGGGTATTGGTCGCCGATTTGCCAACATCGTCTGCAAGAAGGCTGATGTTGACATGAACAAGAGAGCTGGTGAGCTGTCTTCGGAAGAGCTGGACAAGCT
CATGACGGTGGTTGCGAACCCACGTCAGTTCAAGATCCCAGACTGGTTCCTCAACAGACAGAAGGATTACAAGGATGGGAAGTACTCCCAGGTCGTTTCT
AACGCTTTGGACATGAAGCTGAGGGATGATCTTGAGAGGCTCAAGAAGATCAGGAATCACCGTGGTCTCCGTCACTACTGGGGCTTGAGAGTCCGTGGAC
AGCACACCAAGACCACCGGTCGCAGGGGAAAGACTGTTGGTGTGTCAAAGAAGCGATAA
AA sequence
>Lus10042603 pacid=23181737 polypeptide=Lus10042603 locus=Lus10042603.g ID=Lus10042603.BGIv1.0 annot-version=v1.0
MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELSSEELDKLMTVVANPRQFKIPDWFLNRQKDYKDGKYSQVVS
NALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G22780 RPS18A, PFL1, P... 40S RIBOSOMAL PROTEIN S18, POI... Lus10042603 0 1
AT4G09800 RPS18C S18 ribosomal protein (.1) Lus10022057 1.0 0.9774
AT4G18100 Ribosomal protein L32e (.1) Lus10009591 1.4 0.9766
AT3G02080 Ribosomal protein S19e family ... Lus10032992 2.0 0.9620
AT4G14320 Zinc-binding ribosomal protein... Lus10000176 3.0 0.9674
AT2G33370 Ribosomal protein L14p/L23e fa... Lus10023730 4.5 0.9529
AT4G26210 Mitochondrial ATP synthase sub... Lus10001771 4.9 0.9505
AT1G07770 RPS15A ribosomal protein S15A (.1.2) Lus10043001 5.5 0.9487
AT2G33370 Ribosomal protein L14p/L23e fa... Lus10011773 5.7 0.9518
AT5G27700 Ribosomal protein S21e (.1) Lus10015173 5.9 0.9569
AT5G12110 Glutathione S-transferase, C-t... Lus10036101 6.2 0.9501

Lus10042603 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.